[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57001.1


[Show Plain Result]

## Summary of Sequence Search
   1::548
 100::367  PF00361 0.0% 37.5  NADH-Ubiquinone/plastoquinone (complex I), various 
  32::89   PF00662 0.0% 32.7586206896552  NADH-Ubiquinone oxidoreductase (complex I), chain 5 
   1::548


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPGRGSGLAVGGIFISALAVLPLSGADAEVALTWFTVGPFELTVSLAADRLGWWMATLVAWIALPVAVYS
PF00361         ----------------------------------------------------------------------
PF00662         -------------------------------wnWvstgsfkinwsfllDslsliflivvltVsslvhlYS


                         -         -         *         -         -         -         -:140
query           VPYMADEAGRQRFFAWLSFFVGMMLALVLSQSLLLLFIAWEGVGLASFVLIGQHHGQAKARQAAFKALLM
PF00361         -----------------------------ssnllliylgwEllglpsylligfwgkspesleaslkyfll
PF00662         isYMaeDpnisrFfaylsl---------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TRLGDMGLLLGWLWMLMITGTTQLPPFFQQVEDGAFTAGTLNLLALLFFLAAIGKSAQLPLTAWLPEAMA
PF00361         talgsllLLlgilllylltgslsfeellk....allnsnlllllsllllvallvKlaqaplhlWlpdame
PF00662         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           APTPVSALIHSATMAAAGVFLVLRLFPLFEHAPLALAVVLWVGAFTALIAALVATAQYDLKRLLAWSTVS
PF00361         gappvsslllaatlviaglylllrllnllessnelsyillilgilsillgslialsqtdiKkllAySsis
PF00662         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           QLGEMMLALGLGGPLGAAFHLTVHATFKSALFLSVGALERATGTRDLRQLGGLGKRLPWTAGAFIASALA
PF00361         hmGyvllgilslnsigielaiillithaffkallFllagliihrsksqdlrnlggllksnpilallllll
PF00662         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           LAGFPLLSGYWSEEELLRQAVSVHTAWGVFMLVLILLAGIYIGRAAMATFGLAPQAVMPANRRESAPLVG
PF00361         llsllGlPpllgFlskf-----------------------------------------------------
PF00662         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           PALGLALAAAGLGAIIKTPIESMLSFEAGSATLTGAWTLSAILASLVGLGVGAWRVYHWGPAPALGGWPS
PF00361         ----------------------------------------------------------------------
PF00662         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           RLVVIIHGLVSGVARAAKAGALVLVWLERGFDGAARSFPTGIDRVSRQSDRRPIGTGP------------
PF00361         ----------------------------------------------------------------------
PF00662         ----------------------------------------------------------------------