[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57113.1


[Show Plain Result]

## Summary of Sequence Search
   1::228
  16::145  PF00149 0.0% 22.3076923076923  Calcineurin-like phosphoesterase 
   1::228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRFKRFSKNLAGKDYVVGDIHGTYSLLAQALERVGFDPSQDRLFAVGDLVDRGPESPDALTWLEYPWFHS
PF00149         ---------------vigDlHgglddletlllilleiaaeekpdlvlflGDlvdrgdwssetlalldyll


                         -         -         *         -         -         -         -:140
query           CRGNHDEFVINAQNLEFDAAWWILVNGGEWWLDLDLTTRNLFSERFKQLPFAMEIETDQGKVGIVHADVP
PF00149         lklllpipvfllrGNHEsdggnsaygflkeqakdprglanaeeeyeelitlltpegelgglsglypelgg


                         +         -         -         -         -         *         -:210
query           ANLNWTRFVAEIERGNPAIHKYALWSRSRATGKCTTPVEGIERVYCGHTVIKGGTLKIVGNVYFIDTGAA
PF00149         eiqee-----------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YTFLGARLTLLPLAYQQS----------------------------------------------------
PF00149         ----------------------------------------------------------------------