[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57125.1


[Show Plain Result]

## Summary of Sequence Search
   1::257
   9::254  PF11932 0.0% 48.3739837398374  Protein of unknown function (DUF3450) 
  36::163  PF04156 0.0% 20.4081632653061  IncA protein 
   1::257


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MPQKLVKLSLYIVLTFVMGATMQGIGAPLESAIDAQVKADQAAARSQRKIDALSEETAELLAEYRQVTTQ
PF11932         --------alallvallllaaaavaaasldqaqeaeqkanaaaaqsqkkidkladqtqellaeieqlqee
PF04156         -----------------------------------lsesesqlseleeeleqleerlaeleseledleed


                         -         -         *         -         -         -         -:140
query           LDSFRTYNRQLENLIRSQKEEFASLQQQLTDIEITQREIVPLMLRMVSSLKQFVALDIPFLPRERQTRIE
PF11932         venlkvyndqleklvenqqqelaslqeqieeieetrqeivPlmlkmldgLeqfveldlPflkeeRlaRle
PF04156         lellqeelksleerlesleesikelakeirelr.............................eeisdlke


                         +         -         -         -         -         *         -:210
query           QLQILMDRADVSLSEKYRRLIEAYQVEVEYGRTIEAYRGTLDMDGKPHTVDFLRVGRTALFFYTLDGKTS
PF11932         kLrelmdradvsvaEKfrriLeayqieadYgrklevyqgeitldgeeievdlLrlGRvalvyqtlDgqea
PF04156         evqelrselerl.qedlqrlqek-----------------------------------------------


                         -         -         -         +         -         -         -:280
query           GRWNAHGQSWVVLPDHYRAAIAEGLLIARKQAPPDLLLLPIQAPEAR-----------------------
PF11932         gvwnaqsrqWqaldseyrsdirkAiriarkqaapeLlkLPvsvs--------------------------
PF04156         ----------------------------------------------------------------------