[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57133.1


[Show Plain Result]

## Summary of Sequence Search
   1::524
 432::523  PF00958 0.0% 65.2173913043478  GMP synthase C terminal domain 
  11::198  PF00117 0.0% 30.5555555555556  Glutamine amidotransferase class-I 
 215::291  PF02540 0.0% 32.8947368421053  NAD synthase 
 372::401  PF02540 0.0% 36.6666666666667  NAD synthase 
  75::182  PF07722 0.0% 26.8518518518519  Peptidase C26 
 228::293  PF03054 0.0% 38.4615384615385  tRNA methyl transferase 
 227::287  PF00733 0.0% 33.3333333333333  Asparagine synthase 
   1::524


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSDLYAHRILILDFGSQYTQLIARRVREAGVYCEIHPYDMAESTLRDFAPRGIILSGGPASTVGETAPRL
PF00958         ----------------------------------------------------------------------
PF00117         ----------liDnydsvtknlaralrelgvkvevvpndadaeeileklknpdgilisgGpgspgavegk
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SPLIFELGVPLLGICYGMQVMAAQLGGRVEVSAQREYGYAQVYVHGHSRLLQNIEDHTTAGGEALLDVWM
PF00958         ----------------------------------------------------------------------
PF00117         ieaikearenkiPiLGICLGmQllaiefggkvi........kekkeehmggnmrlghdgkaallyglpne
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF07722         ----lergvPvlgiCrGlqllnvalggtlyqdikeepglsdhreheqdasshavslekgsllarllgaee
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SHGDRVIGLPEGFKRIAATAHAPLAGMADEKRRFYGFQFHPEVTHTRQGIRILERFIYDICGCEALWEPR
PF00958         ----------------------------------------------------------------------
PF00117         vivrhrHsyevnpkellpeglevtaksedggeimaivekknpivgvQFHPEssstpgg------------
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF07722         ievnslHhqaikelakglevlAtaedgvieaieseeakyfvl----------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           HIIAKSIENIRTKVGADTVLLGLSGGVDSSVAAALLHKAIGDQLICVFVDNGLLRQGEADQVMATFARHL
PF00958         ----------------------------------------------------------------------
PF00117         ----------------------------------------------------------------------
PF02540         ----dflkeyvkksgakgvvlGlSGGvDSalvaalavkalgkenvlalimP.ssvsseedvedalalaek
PF02540         ----dflkeyvkksgakgvvlGlSGGvDSalvaalavkalgkenvlalimP.ssvsseedvedalalaek
PF07722         ----------------------------------------------------------------------
PF03054         -----------------kvvvalSgGVDSsvaalllkeqg.yevigvfmknweeedeegkeccaeedlkd
PF00733         ----------------vpvgvlLSGGlDSsliaalaaresskplktfsvgfeeseadea.gyaelvaehl


                         -         *         -         -         -         -         +:350
query           GIKVIHISAETRFLEALAGVIDPEAKRKIIGRVFIEVFEEEAAKLPNAQWLAQGTIYPDVIESAGGKTGK
PF00958         ----------------------------------------------------------------------
PF00117         ----------------------------------------------------------------------
PF02540         lgiesktidik-----------------------------------------------------------
PF02540         lgiesktidik-----------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF03054         aervaeklgiple---------------------------------------------------------
PF00733         gtehvei---------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           AQVIKSHHNVGGLPEELNLKLLEPLRELFKDEVRQLGTELGLPFELVYRHPFPGPGLGVRILGEVKKEYA
PF00958         ----------------------------------------------------------------------
PF00117         ----------------------------------------------------------------------
PF02540         ---------------------lapiaellKtevyeLakrlnvPervikkaP-------------------
PF02540         ---------------------lapiaellKtevyeLakrlnvPervikkaP-------------------
PF07722         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           DLLRLADAIFIEELHAHDWYDKVSQAFAVFLPVKSVGVMGDGRCYDFVVALRAVESVDFMTARWAHLPYD
PF00958         -----------eelkkaglykkvwqafavllpvksvGvqgdkRtysyvvvlRavetsdfmtadvaelple
PF00117         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           FLDHVSRRIINEVAGISRVTYDISGKPPATIEWE------------------------------------
PF00958         vLeeiskrivnevegvsrVvyditsKPPaTiEw-------------------------------------
PF00117         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF02540         ----------------------------------------------------------------------
PF07722         ----------------------------------------------------------------------
PF03054         ----------------------------------------------------------------------
PF00733         ----------------------------------------------------------------------