[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57138.1


[Show Plain Result]

## Summary of Sequence Search
   1::510
  16::99   PF02195 0.0% 24  ParB-like nuclease domain 
   1::510


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTAPDESAQVHGISRVDVTHIHHYSRNPRRQQNPEYDRIKASIRAEGLDQPLVLSQEPGTSDYVLHSGGN
PF02195         ---------------vplseirpsplqprldspekleelvasikeagllqPiivrkvr.qgryeii.dGe


                         -         -         *         -         -         -         -:140
query           TRLKILKDLFEETGDDRFRWVNCVIKPWSQESNLLFAHLRENELRGALPFIDKALAVFDAKALLEKELAV
PF02195         rRlrAakrlg.......akevpvivlelt-----------------------------------------


                         +         -         -         -         -         *         -:210
query           ETLSQRQLEELFRERGFGLSHSMISKMGYAVDTLWPVMPKALAAGLGRPQVEKIRALERAAREIWDRRQL
PF02195         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GEDMDFNAVFLELCRRHDCSEWDIQPLRDALENEIADESEQNRQVVYLEMEAQLSGRPFDFVSQPVEGEE
PF02195         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EEQGGTSDKVCRQEKNQSADIDPVNGSSLGREPKPTQPLDSNKPNGESGAKTPAPEFTQNRKTSLTSRDL
PF02195         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RSLRAQLWECAAALAEHHGLGEAVIQLKDQGLGLLLVEVPPQELIDTLDPDMLGLVSALWWQLAASAELT
PF02195         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VAPIDIVLHYLNKSSALHEALASHDAGLLFSSVWTPDPGHMSSLLWQQLNPPDWQVLLRMMETYRAIKRL
PF02195         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           AYDTGIELWVPIAGGGNVIQ--------------------------------------------------
PF02195         ----------------------------------------------------------------------