[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57191.1


[Show Plain Result]

## Summary of Sequence Search
   1::442
  53::125  PF05598 0.0% 32.3943661971831  Transposase domain (DUF772) 
 279::398  PF01609 0.0% 20.1754385964912  Transposase DDE domain 
   1::442


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKPQTPPDLPTDDLFRHRLENLIDTRHELAKLAALIDWEFFDAQWGEAFCENGRPAIATRLIAGLHYLKH
PF05598         ----------------------------------------------------Grpayppelmlkllllqy
PF01609         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TYGLSDEQVVQRWAENPYWQYFCGERYFQHELPLNPSSLTRWRQRLGDEGMESLLSATIDAAIASKAVKA
PF05598         lfglrSdreleealrdnisfrwfcg.ldle.ekvPdhstlsrfrkrlreheller---------------
PF01609         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RDLKCVTVDTTVQEKAIAFPTDSKLYNRARERLVRLAKAHGVPLRQSYVRVGPRLLFKNNRYGYARQTRR
PF05598         ----------------------------------------------------------------------
PF01609         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           MRRTAAKLKTVLGRVVRDIERKLPKQSASVQAAFAESMALTKRLLDQQRHDKNKLYALHAPEVECIAKGT
PF05598         ----------------------------------------------------------------------
PF01609         --------------------------------------------------------------------kr


                         -         *         -         -         -         -         +:350
query           AHKRYEFGVKVSIATTNRSNLVVGAQSLPGSPYDGHTLKKALHQVERLTGQRPERCYVDLGYRGHDVDDV
PF05598         ----------------------------------------------------------------------
PF01609         ykggkyrygyklhivvdlrgglllsvqvtpgnvhDektlleqlldtlpine....vlvlaDaGYaseell


                         -         -         -         -         *         -         -:420
query           DVFKARQKRGVTRTIRRELKRRNAIEPIIGHMKNDGLLHRNYLKGVEGDAINAILCGAGQNLRLILRYLR
PF05598         ----------------------------------------------------------------------
PF01609         ealeekgikyiirlkgnankkqkkeerlfekdglnkksseyerlrrvv----------------------


                         -         -         +         -         -         -         -:490
query           IFWLKIQPAFIQYLLLAPPRAA------------------------------------------------
PF05598         ----------------------------------------------------------------------
PF01609         ----------------------------------------------------------------------