[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57445.1


[Show Plain Result]

## Summary of Sequence Search
   1::325
 130::323  PF00528 0.0% 30.3867403314917  Binding-protein-dependent transport system inner me 
   1::325


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLAYIVRRILYAIPILVGVNILTFALFFGINSPDDMARMHLGTKRVTQEAIDAWKRERGYDKPLFWNSDA
PF00528         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KGEDKFTETIFFTKSISLFLFQFGHADDGRDIGHDLRTRMWPSLAIAAPIFIGGLLVNTTFALLMVFFRG
PF00528         -----------------------------------------------------------llGilaalnrn


                         +         -         -         -         -         *         -:210
query           TYLDLGGVVLCVALMSISTLFYVIMGQYLVGKLMHLVPVSGYVGGLDAFKFIILPIIIGIISGIGAGARW
PF00528         kkldkllrpliivlsslPsfvlaillvlvf.............vilsilghlilpviillllsaapyvrl


                         -         -         -         +         -         -         -:280
query           YRTLFLEEVGKDYVRTARAKGLSEFKVLFKHILKNALIPILTGAVVILPTLFLGSLILESFFGIPGLGSY
PF00528         irraalrslpkdlveaaralGasrwqifrkvvlPnalppiitglilafggllggavlleflgswpGlgtl


                         -         *         -         -         -         -         +:350
query           TIDAIQAQDFAIVRAMVFLGSVLYILGLILTDISYTLVDPRVRLN-------------------------
PF00528         lleailgydyseisnggvlalviavlllnlvadilqrlldprv---------------------------