[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57498.1


[Show Plain Result]

## Summary of Sequence Search
   1::193
  12::137  PF00578 0.0% 35.042735042735  AhpC/TSA family 
  12::145  PF08534 0.0% 31.2 PF08534 Redoxin 
   1::193


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MARTESMMLDLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALSQFAREYQPKG
PF00578         -----------gdkapdfelk.dtdgkkvslsdlkgkpvvLffypkdfcpvCttelpalaelyeefkkkg
PF08534         -----------GdkaPdftlplvatdgktvslsdfkgkkvvlvfvpgafcptCsaehpyleklaklakek


                         -         -         *         -         -         -         -:140
query           LAIVGISVNDVENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAACTPDFFLFDKNHKLVYRGQF
PF00578         vevigvsvdspe........shkkfaeknelnfpllsDeegevakaygvlneekglalratfvidke---
PF08534         gvdvvavvaqndaf........vkeawakeglkipvlsDesasfakalglrltedasagirtpryavide


                         +         -         -         -         -         *         -:210
query           DDSRPGNDLPVTGEDLQTAVKAVLSGQPIPNEQRPSMGCNIKWKPGNEPDYFG-----------------
PF00578         ----------------------------------------------------------------------
PF08534         dgkvv-----------------------------------------------------------------