[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57747.1


[Show Plain Result]

## Summary of Sequence Search
   1::214
  22::210  PF00510 0.0% 31.0344827586207  Cytochrome c oxidase subunit III 
   1::214


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSDKHTAVAEQFDDPEQEYHAATLGMWVFLATEVLFFGVLFASYAVSRFNYPEAFAEASRHTDIVLGTIS
PF00510         ---------------------lklgvilfivsevllflalfwaffhsslsPtvelgavWpPvgikvlnpl


                         -         -         *         -         -         -         -:140
query           TGVLLTSGFTMALAVRSAKLGRDKAIIGFLVLTILLAIAFLFIEGTEYYQAYGEQLIPAFNFMYEGAHEK
PF00510         evpllntiillssGvtvtyahhsliegnrkkalsgllltillalvftllqlveYvea.......sfti.s


                         +         -         -         -         -         *         -:210
query           PVELFFFLYFLMTGMHAVHVTIGILIMAAIAIMAGRRRFTSYYYTPVELTGLYWAFVDIVWIFLYPLFYL
PF00510         Ds.......vyGsvfflatGfhglhvivgtifllvsllrllkyhltkehhlgfeaailYwhfvDvvwlfl


                         -         -         -         +         -         -         -:280
query           VART------------------------------------------------------------------
PF00510         ----------------------------------------------------------------------