[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57806.1


[Show Plain Result]

## Summary of Sequence Search
   1::212
   5::135  PF00578 0.0% 37.1900826446281  AhpC/TSA family 
   6::142  PF08534 0.0% 23.8461538461538 PF08534 Redoxin 
 156::194  PF10417 0.0% 39.4736842105263  C-terminal domain of 1-Cys peroxiredoxin 
   1::212


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MALHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALS
PF00578         ----vgdkapdfelkdtdgkkvslsdl..kgkpvvLffypkdfcpvCttelpalaelyeefkkkgvevig
PF08534         -----GdkaPdftlplvatdgktvslsdfkgkk.vvlvfvpgafcptCsaehpyleklaklakekgvdvv
PF10417         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYP
PF00578         vsvdspeshkkfaekne......lnfpllsDeegevakaygvlnee..kglalratfvidkegki-----
PF08534         avvaqndafvkeawak......eglkipvlsDesasfakalglrltedasagirtpryavidedgkvvyl
PF10417         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           PSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVIVPSLTDPEVLKEKFPKGYEEIKPYLRMTPQP
PF00578         ----------------------------------------------------------------------
PF08534         ev--------------------------------------------------------------------
PF10417         ---------------ALQladkhgvatPAnWkPGdkvivpPppteeea.vkryl----------------


                         -         -         -         +         -         -         -:280
query           NK--------------------------------------------------------------------
PF00578         ----------------------------------------------------------------------
PF08534         ----------------------------------------------------------------------
PF10417         ----------------------------------------------------------------------