[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA57987.1


[Show Plain Result]

## Summary of Sequence Search
   1::397
  69::277  PF01385 0.0% 28.921568627451  Probable transposase 
 291::359  PF07282 0.0% 43.2835820895522  Putative transposase DNA-binding domain 
   1::46   PF12323 0.0% 52.1739130434783  Helix-turn-helix domain 
 323::368  PF05605 0.0% 23.9130434782609  Drought induced 19 protein (Di19) 
   1::397


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLKATKIRLYPTREQAEFLNRQFGSVRFCYNTGLRIMSHRYKRHGQSLSAKYDIKKLLPVAKKSRKYGWL
PF01385         --------------------------------------------------------------------ky
PF07282         ----------------------------------------------------------------------
PF12323         MlkaykyrlyPtkeQeekLaktfGcaRfvYNkaLaerkeaykeegk------------------------
PF05605         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KEADSVALAQACINLDKAFQRFFKEKKGYPRFKRKRGKQSSYHCMSVSCGESWVKVPKLGPIKARVHRSV
PF01385         kelssqsaqqvlkklaeawksFfallkkkkkgklakpPkYkkkekgrliviirndrikvdrgklelpvgd
PF07282         ----------------------------------------------------------------------
PF12323         ----------------------------------------------------------------------
PF05605         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           EGKLKSITLSRTVTGKHYASLLYETEQPVPEPMTAIDATKVLGLDMGLSHLAIDSTGRKVANPRFIKQVQ
PF01385         fkleletikgrlkrrlkeqvrleiiydetrgkwyasivveveee....epkpkgnkaagiDlGinnlatv
PF07282         ----------------------------------------------------------------------
PF12323         ----------------------------------------------------------------------
PF05605         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           KNLKRKQQSLSRKQKGSSKRAKARLLVAKAHERVADARSDFQHKLSRQIVDDNQAVIVETLKVNNMMKNA
PF01385         vtekgeaflyngrrlksdnqylnkeiaelqsklkkskn.rktsrklarlhrkrsrrrkdflhklsrk---
PF07282         ----------------------------------------------------------------------
PF12323         ----------------------------------------------------------------------
PF05605         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           KLAKHIGDASWHALIAKLAYKAKEQGKHLVKIDPWFASSKTCHVCQHKMDAMPLNIRSWACPTCHTRHDR
PF01385         ----------------------------------------------------------------------
PF07282         ----------frklqeqleykakeyGikvievnpay.TSktCsvCgsknke.alsgrlfkCpnCgfeadr
PF12323         ----------------------------------------------------------------------
PF05605         ------------------------------------------sLCaHideeHpveakngvCpvCakrvgk


                         -         -         -         -         *         -         -:420
query           DINAALNIQHQGILKLKAEGLSVSAHRGLRKSGMPPVAAVEVGSSVR-----------------------
PF01385         ----------------------------------------------------------------------
PF07282         DvnAaiNil-------------------------------------------------------------
PF12323         ----------------------------------------------------------------------
PF05605         dlveHitvQHsnlfkvqr----------------------------------------------------