[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58119.1


[Show Plain Result]

## Summary of Sequence Search
   1::258
  68::75   PF00132 0.0% 62.5  Bacterial transferase hexapeptide (three repeats) 
  85::89   PF00132 0.0% 100  Bacterial transferase hexapeptide (three repeats) 
  92::108  PF00132 0.0% 29.4117647058824  Bacterial transferase hexapeptide (three repeats) 
 119::132  PF00132 0.0% 42.8571428571429  Bacterial transferase hexapeptide (three repeats) 
 137::150  PF00132 0.0% 42.8571428571429  Bacterial transferase hexapeptide (three repeats) 
   1::258


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFKRLQEEIKCVFERDPAARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAISTLSRWLTGIEIHP
PF00132         -------------------------------------------------------------------Igp
PF00132         -------------------------------------------------------------------Igp
PF00132         -------------------------------------------------------------------Igp
PF00132         -------------------------------------------------------------------Igp
PF00132         -------------------------------------------------------------------Igp


                         -         -         *         -         -         -         -:140
query           GAQIGQRFFIDHGMGVVIGETAEIGNDCTLYHGVTLGGTSWQKGKRHPTLGNNVVVGAGAKVLGPIHIGS
PF00132         gvvIg---------gvvIg--viIGdnvvIgpgvvIgd----------iIGdnvvIgpgvvI----iIGd
PF00132         gvvIg---------gvvIg--viIGdnvvIgpgvvIgd----------iIGdnvvIgpgvvI----iIGd
PF00132         gvvIg---------gvvIg--viIGdnvvIgpgvvIgd----------iIGdnvvIgpgvvI----iIGd
PF00132         gvvIg---------gvvIg--viIGdnvvIgpgvvIgd----------iIGdnvvIgpgvvI----iIGd
PF00132         gvvIg---------gvvIg--viIGdnvvIgpgvvIgd----------iIGdnvvIgpgvvI----iIGd


                         +         -         -         -         -         *         -:210
query           GVRIGSNSVVVKSVPANTTVIGVPGRMVQSKDQRREAKHQAMAKRIGFDAYGTPQDTPDPIERAIHGLIE
PF00132         nvvIgpgvvI------------------------------------------------------------
PF00132         nvvIgpgvvI------------------------------------------------------------
PF00132         nvvIgpgvvI------------------------------------------------------------
PF00132         nvvIgpgvvI------------------------------------------------------------
PF00132         nvvIgpgvvI------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           HIQRLDERIEQMTAEIKNLGGDLPGEHLPSLDEEQARQVAEDKSAIAK----------------------
PF00132         ----------------------------------------------------------------------
PF00132         ----------------------------------------------------------------------
PF00132         ----------------------------------------------------------------------
PF00132         ----------------------------------------------------------------------
PF00132         ----------------------------------------------------------------------