[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58132.1


[Show Plain Result]

## Summary of Sequence Search
   1::206
   2::192  PF02223 0.0% 41.9354838709677  Thymidylate kinase 
   1::206


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLEGIEGAGKSTQLKFIQQLLQSTEKNVIVTREPGGTFLGEQIRELLLSPRLEGMSADTELLLMFAARVE
PF02223         -iEGlDGaGKttqaellkeklkeqgikvvltrepggteiGelirelll..keeeleelteallfaadrie


                         -         -         *         -         -         -         -:140
query           HVQQVIFPALAAGKWVLCDRFTSASYAYQGGGRELPLSRIAKLESWALNCLRPDLILLFDVPVRLGLQRA
PF02223         hleekikpalkqgktvivdRylfSslaYqgakegvdldlvlslnedvlld.kPdltflldvdpevalkRl


                         +         -         -         -         -         *         -:210
query           TTRCQQLDRFEQEKIDFFDRARTIYLSLAKKYPDQYRLIDSSLPLTRVQEAIQKVIMAFLEENRDA----
PF02223         rkrge.ldeeeeeqldflrkvrekylelak.ekeriliidasksieevheeI------------------