[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58185.1


[Show Plain Result]

## Summary of Sequence Search
   1::212
  11::192  PF00753 0.0% 29.2134831460674  Metallo-beta-lactamase superfamily 
   1::212


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHIDHAGGAGELAR
PF00753         ----------vgvnsyLve..gdggaiLiDtGlgteaaealllallglgpkdidaiilTHaHaDHiGGlp


                         -         -         *         -         -         -         -:140
query           RLEVPIEGPQIEDEFWIDSLPAQSEMFGFPPVRAFVPDRWLEQGDRVSFGKVVLNVYHCPGHTPGHVIFF
PF00753         glleafpapvvygaeearallrlalrdvlkrkk.pvrallpdvdeevddgilggrrllfvtghpghgpgh


                         +         -         -         -         -         *         -:210
query           HPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRLFPLGDEVRFIPGHGPMSTFGEERQSNPFVGE
PF00753         gvvylgggkvlftGDllfaagtgrlgldltlrgakvrdpslwekyldsldkl------------------


                         -         -         -         +         -         -         -:280
query           KI--------------------------------------------------------------------
PF00753         ----------------------------------------------------------------------