[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58385.1


[Show Plain Result]

## Summary of Sequence Search
   1::232
 129::217  PF02517 0.0% 32.9545454545455  CAAX amino terminal protease family 
   1::232


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNRRQAWIDIIFALILVGVSAIAVGLISAFMGQHQFFLLLALQGIAILLGLRFLLAVRGQSWRHLGLQVL
PF02517         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           TLKDLGRALIGFVSCMGANMVLTTLVFITDTQSLKQHVDALKIIGTQLSSEISFAGIAALMFFVGVYEEI
PF02517         ----------------------------------------------------------laaiiapviEEl


                         +         -         -         -         -         *         -:210
query           MARGFLLARCRLALGGLWGPVLLSSFLFGLGHLYQGWIGVAQTTLFGIVLAILTVRWGTLWPAIFAHAML
PF02517         ifRgllllllekkasglla.illsailfglvHvdtlqldsstliqilpafiaglifgylylrtkslwapi


                         -         -         -         +         -         -         -:280
query           NIFSLAILEQFAEQSSFSIFQF------------------------------------------------
PF02517         laHalnn---------------------------------------------------------------