[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58418.1


[Show Plain Result]

## Summary of Sequence Search
   1::538
  36::460  PF00501 0.0% 34.718826405868  AMP-binding enzyme 
   1::538


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSRIHSANSLVHSLVLDNALKGPDASALVHGDQTLTYASLGETVEACARGLLALGLASSERVAIYLPKRP
PF00501         -----------------------------------TYreldervnrlaagLrklGvkpgdrVaillpnsp


                         -         -         *         -         -         -         -:140
query           ETVVTLFGAAAAGGVFVPINPLLKPRQVAHILRDCNVRVLVTASNRIDFLQDALAECHDLRSLVIVDAPT
PF00501         ewviaflaclkaGavyvpvyptlpaerlayilndseakvlitddelltklkeaaskelakealiivr..s


                         +         -         -         -         -         *         -:210
query           QTIEKLAQPMAISWERLLSLGTTQQSPGHRRIDSDMAAILYTSGSTGRPKGVVLSHRNLVAGAQSVAQYL
PF00501         epae.....svgeeellleleslkkasteppkvplkpddlayiiyTSGtTGkPKgVmlthrnllalvagi


                         -         -         -         +         -         -         -:280
query           ENNSNDRLLAVLPLSFDAGFSQLTTAFSVGASVVLMEYLLPKDVIKSITRHGITGITAVPPLWVQLASLA
PF00501         akrvglkpddrvlsllplafdgsvleilgplllGatlvlvspedlkdpalllddiekykvtvlalvptll


                         -         *         -         -         -         -         +:350
query           WPPEAADTLRYIANTGGRMPKAATTALRRSLPQTKVFLMYGLTEAFRSTYLPPEEVDKRPDSIGKAIPNV
PF00501         elllkapekkkldlsslrlilsggeplspellrrlreafggipivngYGltEttvivtvslpgdeetkpg


                         -         -         -         -         *         -         -:420
query           EIQVAREDGSLCLPGESGELVHRGVLVAMGYWNDPKKTAERFRPTPGQPPELPLTEIAVWSGDTVRMDED
PF00501         siGrplpgveikivdeegkevppgevGEllirgpsvakGYlkdpeltaeafvedgwk.........lyrT


                         -         -         +         -         -         -         -:490
query           GFFYFIGRQDEMIKTSGYRVSPTEVEEVLYQAGLVAEAAVVGVLHPKLGQGIVAIVKPNKDNFDPEDLLA
PF00501         GDlgridedGyleiiGRkkdqvkirGeriepgeiEsvlle------------------------------


                         *         -         -         -         -         +         -:560
query           TCRAELPNFMVPLAVIVSENLPRNTNGKIDRRALAMEFELLFKEQTAP----------------------
PF00501         ----------------------------------------------------------------------