[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58511.1


[Show Plain Result]

## Summary of Sequence Search
   1::111
   2::105  PF01710 0.0% 42.7184466019417  Transposase 
  16::46   PF04218 0.0% 38.7096774193548  CENP-B N-terminal DNA-binding domain 
   1::111


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MMRCSIDLRKRVIDFVRGGGSKAEAARRFQVGRASIYRWLSQDDALCYERPGPRRSHKLDWEALRVHVED
PF01710         -maysldlRkkvldyiesggsiteaskvfkigratiyrWLk.reklgalkvevrkrkKidrdeLkedvkd
PF04218         ---------------leegeSkaelarrfnvpestlsdilknKkkl------------------------


                         -         -         *         -         -         -         -:140
query           KAALTYKERARHFGVSYYCIWHAMHKMGLTRKKNDGVHAAL-----------------------------
PF01710         npdallkerakkfgvtpssilyalkkmkitrkKke-----------------------------------
PF04218         ----------------------------------------------------------------------