[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58618.1


[Show Plain Result]

## Summary of Sequence Search
   1::690
  27::682  PF00771 0.0% 56.2021439509954  FHIPEP family 
   1::690


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNTAAVRGHLREVGRNGLGAPLLLLLMLAMMVLPLPAALLDLLFTFNISLALVVLLAGVYARRPLDFSSF
PF00771         --------------------------ilamlilPlpalllDlllalnialsvlillvalyikkpldfsvF


                         -         -         *         -         -         -         -:140
query           PTILLLATLMRLALNVASTRVVLLEGHTGSDAAGKVIQAFGEFVIGGNYAVGLVVFFILVLINFVVVTKG
PF00771         PslLLittLlRLaLnvastrliLlege...daaGkvieaFGefvvggnlvvGlvvFlilvivnfiVitkG


                         +         -         -         -         -         *         -:210
query           ATRISEVSARFTLDAMPGKQMAIDADLNAGLIDQEEARLRREEVMQEADFYGSMDGAGKFVRGDAIAGIL
PF00771         aeRvaEVaARFtLDamPGKQmaIDaDLnaGlideeeAkkrReelekEadfyGamDGAsKFVkGDAiagii


                         -         -         -         +         -         -         -:280
query           ILLINVAGGLAVGLLQHDLSFSEAARNYTLLTIGDGLVAQIPSLVLSTAAGILVTRVSHAQDMGSQILAQ
PF00771         illiNiigGlliGvlqhgmslgeaaetytlltiGDGLvsqiPaLliSvaagiivtrvseeenlgeeiveq


                         -         *         -         -         -         -         +:350
query           LFKNPKSLAVVAVVLGSMGLIPGMPNLAFLGLALLCGFGVWWLGKRQKAEVAPTPPMAAPSETPELSWED
PF00771         llaspkalliaavlllllalvpglPklvflllaalllllayllkkkkkeeekeeeeeekeeeeeeeeeee


                         -         -         -         -         *         -         -:420
query           IPPVDPIGLEVGYRLIPLVDKTQGGQLMGRIKGVRKKLSQDWGFLIPPVHIRDNLNLAPIAYRITLFGVT
PF00771         sveevlkvdplelelgyklielvdeeqggellerikairkklaeelGvvlpeirirdnlelkpneyrikl


                         -         -         +         -         -         -         -:490
query           VGEAEVFPEREMAINPGQVFGKVEGTPAQDPAFGLEALWIEPAQREQAQMHGYTVVDAGTVIATHLSQIL
PF00771         kgvevaegelkpdkllaidsgeekeelegeetkepafgleavwieeeekeeaekagytvvdpstvlathl


                         *         -         -         -         -         +         -:560
query           QNHAHGLLGREEVQKLLENLAKTAPKLVEGLVPEILPLSIVQKVLQQLLEEGVPIRDMRTIVESLTEHGL
PF00771         sevlkknaaellgrqevqklldelekeapklveelvpkklslselqkvlqrLlkervsirdlrtileala


                         -         -         -         *         -         -         -:630
query           RSQDPAILTAIIRIALGRFIIQCFNGLEKELQVISIAPALEQLLLASLQTASEGGGLNMEPGLAEKLHLT
PF00771         eaaekekdvelLteavRqaLarqivqklaeekgelkvitldpeleqllreslkqteegselalepelaek


                         -         +         -         -         -         -         *:700
query           LRDSVQRQEAAGKPAILLVQGVLRPWLARFVRHAIPELKVLSYNEIPEDKQVRIVASVGS----------
PF00771         llesvkealekleakgekpvllvspdlRrllrkllerelpelaVlsyqEipe------------------