[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58626.1


[Show Plain Result]

## Summary of Sequence Search
   1::171
  19::171  PF03748 0.0% 34.2465753424658  Flagellar basal body-associated protein FliL 
   1::171


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAESSTLDAETRNGGGSKKSLIILICALIILLIIAVAGALYLTGVIGPQAVTGEVSADAARTNQPAIYHS
PF03748         ------------------kkkliiilllllllvvgggggvffllsgkqeaeqaaaaeaeeaaaaapakpi


                         -         -         *         -         -         -         -:140
query           LDPAFVVNFQHQSQHRIRFLQTKMEAMARDQEVIEALQTHMPAIRNTLLLLLSQQDYETMRTVEGKERLR
PF03748         fvple.pfvvnladd..ggerylkvgitlevedekaaeeleekmpeirdailmlLsskteeelstaegke


                         +         -         -         -         -         *         -:210
query           EAAREEINLILEAQAAVSGVEAVFFTGFVMQ---------------------------------------
PF03748         klkkelleeinrpllegk....VedVlFtsf---------------------------------------