[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58831.1


[Show Plain Result]

## Summary of Sequence Search
   1::261
 223::254  PF06429 0.0% 65.625  Domain of unknown function (DUF1078) 
   5::35   PF00460 0.0% 51.6129032258064  Flagella basal body rod protein 
   1::261


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MNQALWIAKTGLDAQQTRMATISNNLANVNTTGFKRDRAVFEDLLYQTVRQPGAQSSQNTLLPSGLMLGT
PF06429         ----------------------------------------------------------------------
PF00460         ----LrtavsALnaqqialdvianNiANanTtGyk-----------------------------------


                         -         -         *         -         -         -         -:140
query           GVRTVATEKLFTQGGLTQTGNSLDMAIQGRGFFQILMPDGSLAYTRDGTFQIDANGQLVTSSGYPVQPGI
PF06429         ----------------------------------------------------------------------
PF00460         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TIPESALSVTVGSDGIVSVLMAGDGTPIQAGNLQLADFINPAGLQPTGNNLFKETASSGVAQTGIPGLNG
PF06429         ----------------------------------------------------------------------
PF00460         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           IGTLVQGALEGANVNVVEELVNMIETQRAYEMNSKAISSTDEMLRFATQTL-------------------
PF06429         ------------NVdlveEmvnlieaqRaYeAnakviqtademl--------------------------
PF00460         ----------------------------------------------------------------------