[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58871.1


[Show Plain Result]

## Summary of Sequence Search
   1::200
  14::142  PF03358 0.0% 19.0082644628099  NADPH-dependent FMN reductase 
   6::125  PF00258 0.0% 20.8333333333333  Flavodoxin 
   3::119  PF02525 0.0% 20.8695652173913  Flavodoxin-like fold 
   1::200


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTKLLVLYYSMYGHVETMAHAVAEGARSVEEVEVTLKRVPELMPEEIARNAGAKLAQEAPIATVDELPEY
PF03358         -------------ntrklaewaaealaea.gaevelidladl.ilplcdedlee.esddlqellekiaaa
PF00258         -----ilYgSetGnteklAkalaeglgehgfnakvvslddvdesleeiehedlllvvtsTfgnGeppeng
PF02525         --kiLiinahprpeksfssalaqafvealeeagphevtvrdLyadflpvlttrdlalayeek.padvese


                         -         -         *         -         -         -         -:140
query           DAIIFGTPTRFGNMCAQMRNFLDQTGKHWMSGALIGKVGSVFTSTASQHGGQETTITSFHSTLLHQGMVI
PF03358         dgviivtPeYngsypgllKnalDrls....kkelrgKpvalvavgggragglraeealrpvla.elgavv
PF00258         esfaeellelkgkeeeagdlsnvrfavfglGdsaypkFcaagkaldekleelGae---------------
PF02525         q.iekllaadvivlqfPlwwfgvPailKgwiDrvftagfafyteeggeg---------------------


                         +         -         -         -         -         *         -:210
query           VGVPYSCQALLNMNEITGGSPYGASTLADADGSRQPSENELTIARFQGEHVAKFTKKVVE----------
PF03358         vp--------------------------------------------------------------------
PF00258         ----------------------------------------------------------------------
PF02525         ----------------------------------------------------------------------