[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58880.1


[Show Plain Result]

## Summary of Sequence Search
   1::163
  35::153  PF01475 0.0% 30.4347826086957  Ferric uptake regulator family 
  39::100  PF03965 0.0% 31.6666666666667  Penicillinase repressor 
  38::93   PF03551 0.0% 27.7777777777778  Transcriptional regulator PadR-like family 
   1::163


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSHTNILVPFKGPSHDHWRCIRNALAVAEKTCASRGLRLTKLRRRVLELIWDRHEPAKAYDILEQLRQEH
PF01475         ----------------------------------aglklTkqRekilevlekseehlsaeevykelkeed
PF03965         --------------------------------------lgelEaevmeivwelge.atvkevveeleee.
PF03551         -------------------------------------rkgllqllvLall.ee.eplyGyelikeleell


                         -         -         *         -         -         -         -:140
query           QAAAPPTVYRALDFLLQTGLIHRVETLNAYVGCGDPDRLHIGQFLLCRRCGTVAELDAPEITGIITREAK
PF01475         peislaTVYrtLklleeaglvkelefedgesryelak....kehhdhlicekCgkviefkddeiekiqee
PF03965         relaysTVktllrrLvkKgllsrekegraf----------------------------------------
PF03551         egllelseGtlYpiLkrLekegl-----------------------------------------------


                         +         -         -         -         -         *         -:210
query           YLGFRVDRQTVEIRGLCPQCSGD-----------------------------------------------
PF01475         iaekegfklvshr---------------------------------------------------------
PF03965         ----------------------------------------------------------------------
PF03551         ----------------------------------------------------------------------