[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58884.1


[Show Plain Result]

## Summary of Sequence Search
   1::193
  69::79   PF02777 0.0% 36.3636363636364  Iron/manganese superoxide dismutases, C-terminal do 
  87::190  PF02777 0.0% 67.3076923076923  Iron/manganese superoxide dismutases, C-terminal do 
   2::81   PF00081 0.0% 50  Iron/manganese superoxide dismutases, alpha-hairpin 
   1::193


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTHRLPELPYALNALEPHISQETLEYHYGKHHQTYVDKLNGLVPGTEFENASLEEIITKASGTLFNNGAQ
PF02777         --------------------------------------------------------------------iD
PF02777         --------------------------------------------------------------------iD
PF00081         -kyeLpeLpYaydaLePhisketlelHhdkHhktYvnnlNkalekleeakkkleelilkklekalrnnag


                         -         -         *         -         -         -         -:140
query           VWNHTFYWNCLTPQGGGEPSGALLEAIEKNFGSFSDFKEKFSQSATTLFGSGWAWLVKNSDGSLDIVGTS
PF02777         vwEHayYld-------gePkgelaeaieedfGsfdefkeefeaaaaalfgsgWawlvkdkeegklkivkt
PF02777         vwEHayYld-------gePkgelaeaieedfGsfdefkeefeaaaaalfgsgWawlvkdkeegklkivkt
PF00081         ghvnHslfwkn-----------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           NAGNPLTEGKTPLLTCDVWEHAYYIDYRNARPKYLEAFWKLANWDFVAKNLAN-----------------
PF02777         enqdnpllegltplltiDvwEHayYldyknarpdyleafwnvvnWdevek--------------------
PF02777         enqdnpllegltplltiDvwEHayYldyknarpdyleafwnvvnWdevek--------------------
PF00081         ----------------------------------------------------------------------