[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA58916.1


[Show Plain Result]

## Summary of Sequence Search
   1::146
  12::141  PF04246 0.0% 44.4444444444444  Positive regulator of sigma(E), RseC/MucC 
   1::146


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MVEASAQVIVKSETYAWVEAERRTSCHGCTLSQGCGTGSIAKYLMIKPIMVKASNPVGAEAGDRVIVGLP
PF04246         -----------eggkvwveterksaCgsCaakggCgtgllakassekklevevenelglkvGdeVevglp


                         -         -         *         -         -         -         -:140
query           EKAFLQGSFLLYMVPLLAMLLGAGLGGTLAPHFGGNEGLEVLLGLGGLAGGLLGVRYMRMGPDLEPKILR
PF04246         esallkaallvYllPLlalllgallgqallls....ellaallgllglllgflilrllakklkkksefqp


                         +         -         -         -         -         *         -:210
query           TVGRQR----------------------------------------------------------------
PF04246         v---------------------------------------------------------------------