[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA59023.1


[Show Plain Result]

## Summary of Sequence Search
   1::212
  29::204  PF01728 0.0% 43.1818181818182  FtsJ-like methyltransferase 
   1::212


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAKRKSHSARWLREHFRDSYVIQAKAQGYRSRAVFKLQEIDTRERLLGPGRVVIDLGAAPGGWSQWAAER
PF01728         ----------------------------yrsRsayKLleidekfkllkvgkgktvvDlgaaPGgwsqvll


                         -         -         *         -         -         -         -:140
query           VGERGRVIAMDILPMLSCPGVQFIQGDFREDNVLAELQNTLAGCVVDLVMSDMAPNMSGMAAVDQPRAIY
PF01728         qrlkeagrvvavDlqpmaplqgvttlqgditdpstqekilealeegerkvdlvlsDgapdvtgvhdldey


                         +         -         -         -         -         *         -:210
query           LGELALAFAQESLGPEGSFLLKTFQGEGFDALYEVIRQDFSRVRIHKPPASRGRSREVYIVARRSRKDNG
PF01728         issqlilaalslalellkpggtfvlklfkgeeaeellkqlrkfFekvsvvkpkasrkesseefl------


                         -         -         -         +         -         -         -:280
query           GG--------------------------------------------------------------------
PF01728         ----------------------------------------------------------------------