[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA59139.1


[Show Plain Result]

## Summary of Sequence Search
   1::372
 277::346  PF07282 0.0% 46.3768115942029  Putative transposase DNA-binding domain 
 118::247  PF01385 0.0% 26.3565891472868  Probable transposase 
 304::319  PF09526 0.0% 18.75  Probable metal-binding protein (DUF2387) 
 306::346  PF09526 0.0% 26.8292682926829  Probable metal-binding protein (DUF2387) 
   1::372


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKTTLQIKLLPDGTQHSALKETMRVFNDACNAIAEVAFREQCASKFELQKLVYADVRKQFGLSAQLTIRA
PF07282         ----------------------------------------------------------------------
PF01385         ----------------------------------------------------------------------
PF09526         ----------------------------------------------------------------------
PF09526         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           IAKVVEAYKRDKSKQCFFKPTGAVVYDQRILSFKGLDRASLVTMQGRVSIPIQMGQYQRVQWHRAKGQAD
PF07282         ----------------------------------------------------------------------
PF01385         -----------------------------------------------lelpvgdfkleletikgrlkrrl
PF09526         ----------------------------------------------------------------------
PF09526         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           LVLVKGAFFLLVVIDTPEAPPIDPSGFIGIDLGITKVATDSDGGSFCGSTVERVRQRYHRLRRRLQSKGT
PF07282         ----------------------------------------------------------------------
PF01385         ke.qvrleiiydetrgkwyasivveveeeepkpkgnkaagiDlGinnlatvvtekgeaflyngrrlksdn
PF09526         ----------------------------------------------------------------------
PF09526         ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           RSAKRHLKKIRRKEAQFRRSQNHIISKRLVEKAKDTGRGIALEELKHIRSRTTVRKSDRAKHSGWSFFQL
PF07282         ------------------------------------------------------------------frkl
PF01385         qylnkeiaelqsklkksknrktsrklarlhrkrsrrr---------------------------------
PF09526         ----------------------------------------------------------------------
PF09526         ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           QSFIEYKAKLAGVFVQYIDPWYTSRTCSACGHADKANRKTQSHFQCVSCGYTDNADINAAINIAARADVM
PF07282         qeqleykakeyGikvievnpayTSktCsvCgsknke.alsgrlfkCpnCgfeadrDvnAaiNilkr----
PF01385         ----------------------------------------------------------------------
PF09526         -----------------------vvvCPkCsemDkirlveedevevveCveCgyteerkdeeevel----
PF09526         -----------------------vvvCPkCsemDkirlveedevevveCveCgyteerkdeeevel----


                         -         -         -         -         *         -         -:420
query           QPMVMRATTAKDSPSTATSLPL------------------------------------------------
PF07282         ----------------------------------------------------------------------
PF01385         ----------------------------------------------------------------------
PF09526         ----------------------------------------------------------------------
PF09526         ----------------------------------------------------------------------