[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA59276.1


[Show Plain Result]

## Summary of Sequence Search
   1::134
  43::115  PF04892 0.0% 23.6111111111111  VanZ like family 
   1::134


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKLMGHLQFIWFWRFLGWLLVAVVVYLSLTSSLPDVKLGIQDQDKLGHFTAYALLAWWFSQTYPARLHGF
PF04892         ------------------------------------------iqkllnlllffpLglllpvlfkrlrsfl


                         -         -         *         -         -         -         -:140
query           FGLFLALLGIALEFLQDLVGDRYFEYGDMLANMLGVVGGCLLARTPAGTALRRLECFWEARGAP------
PF04892         rvl.vlslllslliEvlQlflpigvfdidDvllNtlGallGylly-------------------------