[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA59308.1


[Show Plain Result]

## Summary of Sequence Search
   1::384
  25::373  PF01098 0.0% 42.8985507246377  Cell cycle protein 
   1::384


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLNRFLSTRQAARGSVSQPDLYLLGAALALAGLGWVMVGSASLAIADGPRFLWRQGIFLLMGLAAAFVVW
PF01098         ------------------------lllllllilGlvviysaslvtslelfedslvlfirqlvylllglvi


                         -         -         *         -         -         -         -:140
query           RIRLIFWERFGPVLLLFGLGLLLLVLMPGIGVEANGSRRWLAIGPISLQPSELVKLFMVVYFSGYLVRRS
PF01098         fvlllriplkfleklakllliislllLvlvklp.igssanGAkrWirlggisiqPsEfvkialilflAav


                         +         -         -         -         -         *         -:210
query           YEVRTTVRGFFFPVGVLTLVGLLLLLEPDFGAVVILFATMLGMLFLGGARLWYFVLLAAIGGVGLAALAW
PF01098         lskkkkvvksrlrellillvivllalvlillqpdlgtavllliillvvlflaglslklilaivlalilvs


                         -         -         -         +         -         -         -:280
query           GSPYRMERLTSFLDPWSDPLDSGYQLTQALIAFGRGEWFGVGLGNSIQKLFYLPEAHTDFLYAVLAEELG
PF01098         aivllilledyqlkrvtsfldpfkdplgsgYqvvqsliAigsGGlfGkGlgnsqqkleyLPeahtDfIfA


                         -         *         -         -         -         -         +:350
query           LVGSLAVIALFTVLVYRALLIGRAAERAGRVFGAYLAYGLGIWIGLQAFINLGVNMGVLPTKGLTLPLMS
PF01098         vigEelGliGllllllLlillivrglrialk...akdrfasllavgivlliliqsfinigvvlGllPvtG


                         -         -         -         -         *         -         -:420
query           AGGSSIIVTCIAVALILRVDLETRFPKTARRGIK------------------------------------
PF01098         lplPflSyGGsSllalliligll-----------------------------------------------