[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA59402.1


[Show Plain Result]

## Summary of Sequence Search
   1::337
  24::324  PF01207 0.0% 37.5862068965517  Dihydrouridine synthase (Dus) 
 199::259  PF00977 0.0% 35  Histidine biosynthesis protein 
   1::337


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLFSYDCKKTIQMADYSKAYKISVAPMMEWTDRHCRYFLRLISHRALLYTEMVTAGALIHGNRARFLAYH
PF01207         -----------------------lAPmagvtdlpfRellrevgatdlvvtemvtakaivreekvtirmls
PF00977         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KSEHPLALQLGGSHPEELALCAQMAEDYGFDEVNLNVGCPSNRVQSGRFGACLMAEPELVAECVAAMAQA
PF01207         eleeetplalQllgsdpallaeaAklvadlgadeIDlNvGCPakkvtkggaGaaLlrkpdlvaqivkavv
PF00977         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           TQIPVTVKTRIGIDEQDSYEALDHFISTVAQAGCRTFIIHARKAWLQGLSPKENREKPPLRYDVVRTIKQ
PF01207         kaveipvtvkirigid..dskenalelarrveaaGaqaltvHgR.......traqnyeg.tadweaIkev
PF00977         ----------------------------------------------------------eanldlveeiae


                         -         -         -         +         -         -         -:280
query           DFPQLTVIINGGITTLEEISEHLELLDGVMIGRAAYHNPYLLAQVDRNFYGDFHPFLTRHEIIEAFLPYV
PF01207         kqavs.ipviaNGdikdaedaqailaetGadgvMigrgalgnPwlfaestavktgeaepapplaeeaeiv
PF00977         evf.iplqvGgGIrsledveelleagadkviigtaavknpelikelaek---------------------


                         -         *         -         -         -         -         +:350
query           AEQLVQGVYLNHMTRHILGLFQGQPGARAWRRHLSENAHRPGAGIEIIREALRQMPC-------------
PF01207         eehlkkleeelgedkglrkarkhlawylkglkaaaelrrelnev--------------------------
PF00977         ----------------------------------------------------------------------