[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA59494.1


[Show Plain Result]

## Summary of Sequence Search
   1::249
   3::231  PF00977 0.0% 39.5555555555556  Histidine biosynthesis protein 
  59::115  PF01207 0.0% 25  Dihydrouridine synthase (Dus) 
 144::229  PF01207 0.0% 27.3809523809524  Dihydrouridine synthase (Dus) 
  58::110  PF01884 0.0% 21.1538461538462  PcrB family 
 173::230  PF01884 0.0% 23.6363636363636  PcrB family 
   1::249


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLLIPAIDLKGGKCVRLRQGRMEDDTVFSDDPVAVALHWAEAGAKRLHLVDLDGAFAGQPVNADIIYHIA
PF00977         --iipalDlkdgkvVrlvkGdrfknlryagdpvelakkyeeegadelhvvDLdaakegreanldlveeia
PF01207         ----------------------------------------------------------gtadweaIkevk
PF01207         ----------------------------------------------------------gtadweaIkevk
PF01884         ---------------------------------------------------------ledvp.eevikvk
PF01884         ---------------------------------------------------------ledvp.eevikvk


                         -         -         *         -         -         -         -:140
query           QALPDMDIQVGGGIRDSDTIQTYLDAGVRYAIIGTKAINAPHFVADACLEFPGHILLGLDAREGKIAING
PF00977         eevf.iplqvGgGIrsledveelleagadkviigtaavknpelikelaekfgsqkivvaiDakkgkvaik
PF01207         qavs.ipviaNGdikdaedaqailaetGadgvMigrgalgnPwlf-------------------------
PF01207         qavs.ipviaNGdikdaedaqailaetGadgvMigrgalgnPwlf-------------------------
PF01884         kvledarlivGGGiksaEkAkelvkaGADvivvGnvveek------------------------------
PF01884         kvledarlivGGGiksaEkAkelvkaGADvivvGnvveek------------------------------


                         +         -         -         -         -         *         -:210
query           WSKLSRHNLIDIAQRFEKDGVEAIIYTDIQRDGMMKGVNIEATSELAKAINIPVIASGGVSSLTEIEALC
PF00977         gwreetgldavelakkleelgageilltdidrdGtlsGpdlellkklaeavkipviasGGvgsledlkel
PF01207         ---dskenalelarrveaaGaqaltvHgRtraqnyegtadweaIkevkqavsipviaNGdikdaedaqai
PF01207         ---dskenalelarrveaaGaqaltvHgRtraqnyegtadweaIkevkqavsipviaNGdikdaedaqai
PF01884         --------------------------------GaledvpeevikvkkvledarlivGGGiksaEkAkelv
PF01884         --------------------------------GaledvpeevikvkkvledarlivGGGiksaEkAkelv


                         -         -         -         +         -         -         -:280
query           QHEQDGIGGAIIGRALYEEKIQLAEALAIAKRLSGESTA-------------------------------
PF00977         k...segvdavlvgsalhege-------------------------------------------------
PF01207         ..laetGadgvMigrgalg---------------------------------------------------
PF01207         ..laetGadgvMigrgalg---------------------------------------------------
PF01884         kaGADvi...vvGnvveekk--------------------------------------------------
PF01884         kaGADvi...vvGnvveekk--------------------------------------------------