[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA59517.1


[Show Plain Result]

## Summary of Sequence Search
   1::515
 150::377  PF00006 0.0% 32.5581395348837  ATP synthase alpha/beta family, nucleotide-binding 
 389::480  PF00306 0.0% 37.7777777777778  ATP synthase alpha/beta chain, C terminal domain 
  30::94   PF02874 0.0% 33.8461538461538  ATP synthase alpha/beta family, beta-barrel domain 
  29::95   PF09378 0.0% 35.5932203389831  HAS barrel domain 
 148::214  PF06745 0.0% 28.3582089552239 PF06745 KaiC 
   1::515


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MQLQLNAAEISELIRKRIEGFEADTEARTEGTVVSLTDGIVRIHGLADVMFGEMIEFPGNTYGLAMNLER
PF00006         ----------------------------------------------------------------------
PF00306         ----------------------------------------------------------------------
PF02874         -----------------------------iGpVvdvefgigrlpgiynalkvelvefgklvlgvalnlgd
PF09378         ----------------------------vvGevss.sdlifrveglkdvrvGeyVeielqdgekvlGmvl
PF06745         ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           DSVGAVILGPYQHISEGDRAKCTGRILEVPVGEALLGRVVDALGIPIDGGGPIEAQATSPIEKVAPGVIT
PF00006         ----------------------------------------------------------------------
PF00306         ----------------------------------------------------------------------
PF02874         dkVriiamgstdGlkrGdeVkdTG----------------------------------------------
PF09378         diergselsndlalvlslkeidesi---------------------------------------------
PF06745         ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           RQSVSQPVQTGLKSIDSMVPVGRGQRELIIGDRQTGKTAVAIDAIINQKGTGIKCIYVAIGQKASSVAGV
PF00006         ---------tgirvlDslfPivqGqttlipGafgcGktvisqslsknsnsdai..iyvgiGergnevaev
PF00306         ----------------------------------------------------------------------
PF02874         ----------------------------------------------------------------------
PF09378         ----------------------------------------------------------------------
PF06745         -------vktgIeglDellkgGipegrvvlitGepGtGKtifalqFlikgaeeygepgvfvtveesaedl


                         -         -         -         +         -         -         -:280
query           VRKLEEHGALEHTIVVAASASESAALQFIAPYAGCAMGEYFRDRGEDALIIYDDLTKQAWAYRQVSLLLR
PF00006         leefrkepimkrttlvantsnepvaareasiytgitlAeyfrdqgknVlliaDslsrwaealreisgrlg
PF00306         ----------------------------------------------------------------------
PF02874         ----------------------------------------------------------------------
PF09378         ----------------------------------------------------------------------
PF06745         rena------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RPPGREAFPGDVFYLHSRLLERSARVNAEHVEKLTEGKVKGKTGSLTALPIIETQAGDVSAFIPTNVISI
PF00006         empadqgypaylfaklaslyeRagka...........gspdriGSvtivaavspaggdfsdpvttstlgi
PF00306         ----------------------------------------------------------------------
PF02874         ----------------------------------------------------------------------
PF09378         ----------------------------------------------------------------------
PF06745         ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           TDGQIFLETDLFNAGIRPAINAGLSVSRVGGAAQTKIIKKLGGGVRLDLAQYRELAAFAQFASDLDEATR
PF00006         tdvfivLdkklaqrkhfPaintlvSyS-------------------------------------------
PF00306         --------------------------------------kqvagklkleLaqyrElaafvqlvGsdaLsee
PF02874         ----------------------------------------------------------------------
PF09378         ----------------------------------------------------------------------
PF06745         ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           KQLERGQRVTELMKQLQYSPMSVGQMAVSLFAANEGFLDDVEVDKIQDFESALQGYMRSSHGELLDKITK
PF00006         ----------------------------------------------------------------------
PF00306         dkltlerarrleefLkQnqysplpvekqvvsiveetidlfyallrgklddlpeeelekig----------
PF02874         ----------------------------------------------------------------------
PF09378         ----------------------------------------------------------------------
PF06745         ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           TGDYSDEIAAELRAAIENFKTTNTW---------------------------------------------
PF00006         ----------------------------------------------------------------------
PF00306         ----------------------------------------------------------------------
PF02874         ----------------------------------------------------------------------
PF09378         ----------------------------------------------------------------------
PF06745         ----------------------------------------------------------------------