[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:PFM for noce0:ABA59518.1


[Show Plain Result]

## Summary of Sequence Search
   1::178
   7::176  PF00213 0.0% 43.5294117647059  ATP synthase delta (OSCP) subunit 
   1::178


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAEKITIARPYANAVFELAQAQKNYDQWSRVLNVFADLARDSEMQILIDDPRYTSEQLIGLFVEIGGDTV
PF00213         ------varrYAkAlfelakekgaldeveeelealkavlaedkklkellsnpavsaeekkdllkkvfkgk


                         -         -         *         -         -         -         -:140
query           TESAKNFIKILADNRRLSVLPEVAALFEQLRAEIEGTLEVEIISAKPLAEEQLNEIASALKRRLGREVTF
PF00213         lseavknflklLaenkRlallpeiaeefeelaaeaegiveaeVtsavpltdeqlkklkaaLekklgkkkv


                         +         -         -         -         -         *         -:210
query           SRKTDESLLGGVIIRAGDLVIDGSAIGKLNQLAASLLH--------------------------------
PF00213         kleekvdpsliGGvvikvgdkviDgSvkgkLerlke----------------------------------