[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA56702.1


[Show Plain Result]

## Summary of Sequence Search
   1::214
  44::214  3.3e-50 42.1% 0051163 00511631 1/1   e-like                                  
  38::211    2e-46 36.8% 0046909 00469091 1/1   e-like                                  
  46::215  1.4e-45 38.2% 0048919 00489191 1/1   e-like                                  
  40::215  4.5e-43 37.5% 0041991 00419911 1/1   e-like                                  
  41::213  9.7e-43 41.0% 0040356 00403561 1/1   e-like                                  
  36::213  8.8e-42 35.0% 0041687 00416871 1/1   e-like                                  
  47::212  3.3e-40 39.2% 0048249 00482491 1/1   e-like                                  
  33::213  8.1e-35 33.5% 0051755 00517551 1/1   e-like                                  
  45::211  2.7e-34 33.3% 0050136 00501361 1/1   e-like                                  
  40::213  1.5e-33 27.6% 0035791 00357911 1/1   e-like                                  
  41::209  2.2e-32 33.3% 0036900 00369001 1/1   e-like                                  
  37::213  1.5e-31 29.1% 0047309 00473091 1/1   e-like                                  
  58::214  1.9e-31 31.0% 0048678 00486781 1/1   e-like                                  
  21::213  9.1e-31 31.3% 0035468 00354681 1/1   e-like                                  
  54::212  2.7e-30 34.5% 0034851 00348511 1/1   e-like                                  
  50::214  1.2e-29 35.6% 0041997 00419971 1/1   e-like                                  
  68::208  1.4e-29 34.4% 0041576 00415761 1/1   e-like                                  
  51::211    3e-29 30.4% 0046155 00461551 1/1   e-like                                  
  64::213  5.3e-29 31.7% 0038017 00380171 1/1   e-like                                  
  67::214  3.9e-28 30.3% 0050151 00501511 1/1   e-like                                  
  37::213  2.4e-27 30.2% 0050105 00501051 1/1   e-like                                  
  52::203    7e-27 29.8% 0044334 00443341 1/1   e-like                                  
  64::208  7.9e-26 28.8% 0038588 00385881 1/1   e-like                                  
  66::212  4.1e-25 32.6% 0041489 00414891 1/1   e-like                                  
  35::214  2.3e-23 28.1% 0048493 00484931 1/1   e-like                                  
  54::213  1.5e-22 28.8% 0050349 00503491 1/1   e-like                                  
  37::202  2.5e-22 29.3% 0036560 00365601 1/1   e-like                                  
  62::211  7.6e-20 26.2% 0051301 00513011 1/1   e-like                                  
  73::215  1.2e-18 21.1% 0047030 00470301 1/1   e-like                                  
  38::192    6e-17 27.2% 0051105 00511051 1/1   e-like                                  
  70::211  5.1e-16 26.1% 0046852 00468521 1/1   e-like                                  
  90::212  7.8e-12 27.6% 0052114 00521141 1/1   e-like                                  
  92::214    5e-08 30.3% 0049833 00498331 1/1   e-like                                  
  64::211  3.3e-07 24.3% 0042536 00425361 1/1   e-like                                  
  56::216  3.4e-07 23.5% 0050435 00504351 1/1   e-like                                  
  94::189  4.1e-07 31.3% 0046350 00463501 1/1   e-like                                  
   1::214


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MARLARTFCDGHHKSQGVRFICLFNPNHIKCLPQILVYLGKASMERLKTKIRDIPDFPKPGVLFKDITPL
00511631   1/1  -------------------------------------------lkellelireigalpkggfllfidils
00469091   1/1  -------------------------------------lvaelllelladriltvglfplksglyfditkl
00489191   1/1  ---------------------------------------------taviPylgyarqdrkllpleaisak
00419911   1/1  ---------------------------------------rvltldlllkqirffldspvdgllyiditkl
00403561   1/1  ----------------------------------------dlllelladriltvglfgkpgflyidilkl
00416871   1/1  -----------------------------------lvakllldagalkfgiftlpsgpisgi.fvdllkl
00482491   1/1  ----------------------------------------------cavipylgyarqdrcakclehpla
00517551   1/1  --------------------------------Pitaklvadlllelladriltfglftlksglqspgffd
00501361   1/1  --------------------------------------------elleldllkfgdfvltyglhsdsyid
00357911   1/1  ---------------------------------------dlhagqilgffdfpldslcispyyyddrpdl
00369001   1/1  ----------------------------------------kacafelly..ydlpdsqiigffkydvdpl
00473091   1/1  ------------------------------------itvvvpylpylrqdltiirdkltsgilfrdyvdr
00486781   1/1  ---------------------------------------------------------Pkpyiafrdilld
00354681   1/1  --------------------elllmidalksakritvvi..pyhplarqlltilrdkptsaklfrdlldr
00348511   1/1  -----------------------------------------------------fsdilldgllirdlarl
00419971   1/1  -------------------------------------------------epitakllaellleagalrvg
00415761   1/1  -------------------------------------------------------------------ltl
00461551   1/1  --------------------------------------------------rqdrklcgrelisaklvadl
00380171   1/1  ---------------------------------------------------------------Yfdiqgl
00501511   1/1  ------------------------------------------------------------------ifkl
00501051   1/1  ------------------------------------krasaldiplvipyltylrddrtpgirfrdladr
00443341   1/1  ---------------------------------------------------gaqsdiffdgelvrdlarl
00385881   1/1  ---------------------------------------------------------------yldffkl
00414891   1/1  -----------------------------------------------------------------diipl
00484931   1/1  ----------------------------------alkrvsaldiplvkplltylrddrtpggdfrlgsgr
00503491   1/1  -----------------------------------------------------rpdvlldgedirelgrl
00365601   1/1  ------------------------------------lrepitaklvadlllragadflipgdlhvdisdl
00513011   1/1  -------------------------------------------------------------lhyfdiqkl
00470301   1/1  ----------------------------------------------------------------------
00511051   1/1  -------------------------------------lvvvpdhpllkhlltilrdkntssidfrflldr
00468521   1/1  ---------------------------------------------------------------------P
00521141   1/1  ----------------------------------------------------------------------
00498331   1/1  ----------------------------------------------------------------------
00425361   1/1  ---------------------------------------------------------------ydrlldv
00504351   1/1  -------------------------------------------------------llFedrpiaakllad
00463501   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           VGDPATLRLAVHQLLHPFLEQDITAVGGIEARGFIFGALVAWELGVGFIPLRKSGKLPYEVRSISYQLEY
00511631   1/1  llldpellrllgellaerlaglkidvvvgveagGiplaaalaralgvplvfvrkegklhgegrtiegsvy
00469091   1/1  lldpelllelarllaeeiaellpgldidvvvgiergGiplaaalaralgvplvlvrkkgklhgttlsvey
00489191   1/1  lvgrfildsgkksiifvdlrkllsdpellllladllaelikelllkidvvvgvelgGiplAaalalrlgl
00419911   1/1  lldpellrelarllaeelaellpleidvvvgiprgGfplaaalaralgvplvlvrkrrklpgttlsreer
00403561   1/1  lgdpellrlladllaerlkdldidvvvgiprgGfplaaalaralgvplvivrkkrklpvqvillsyeley
00416871   1/1  lvdpellrrlaeelaeriagldidvvvgvprgGiplaaalaralgvplvivrkkaklpgddtlsvgyvle
00482491   1/1  klklrflldsgkpsiifidllkllgdpellealadllaelikellldidvvvgvplrGfplaaalalrlg
00517551   1/1  irvllldpellrllarllaelikdlgleidvvvgpdagGiplaaalalalgvplvfvrkerk........
00501361   1/1  ffkvlvdpellrrlarllaerlkd.didvvvgvplgGfplaaalaralglplvivrkrrkyvlpgfigls
00357911   1/1  lldpeliyelvrrlaeelaeklggkpdvvvgvprgGvplaaalaralgvplvivrkrrklpvdflsvssy
00369001   1/1  l.....grllaeelaerlkdldidvvvgvprgGiplaaalaralgvplvivrkrrkyygrtqiglgreer
00473091   1/1  lltlldlealrilgffdipvdtplaelllalrglkqlvvvgilrgGvplaaalaralpgaplgfvrkrrk
00486781   1/1  lleirealrrlaellaerlkglelldlgkpdvvvgilrgGvplaaalaralgllgvpvpl.gfllvssyr
00354681   1/1  lgrllvyeallhlpqiqgffdtpvdnlyagvldldnlvvVsilrgGvllaaalakllgdaplgfilirrd
00348511   1/1  lad.........eiaerlkglkpdvvvgilrgGvplaaalaralgvplvivrkvgklgvtsytddqyale
00419971   1/1  efdlhsgqispiffdi.kvlldpellralgrllaelirelgldidvvvgvplgGiplaaalaralglpln
00415761   1/1  lldpeqiqalidelaeklkelykidvvvgvlrgGlplaaalaralgvplvivrkvgkyp..........e
00461551   1/1  lallgydfvltsdlhslkyqdifillvdilallailaaiiekdlgpkplvvvgilrgGfpfaaalarelg
00380171   1/1  lidpedilaaiellaeeiaeklkgglepdvvvgvprgGvplaaalaralgvplaivrkrrksyggtfsls
00501511   1/1  lvdpelilrlgrllaeeikdlkpdvvvgvprgGfplaaalaralgiplvivlkrrkytget......lel
00501051   1/1  latlllhealfdlpvddlealtplaeelaelr.glkqlvvvgilrgGvplaaalaralpgaplgiirkrr
00443341   1/1  lae.........eiaerlkgldpdvvvgiprgGvplaaalaralglplvivrkvgklgrtryrdeqkels
00385881   1/1  lvdpeliralarllaeeilelyggepdvvvgvprgGvplaaalaralgvplvivrkrrksygd......t
00414891   1/1  lldyevirelgrllaeeiaerlkglkpdvvvgiprgGfplaaalaralglpl.....ggklpvgfvrker
00484931   1/1  lstlllyealfdlpvddlealtplaeelaell.dlkidvvvgilrgGlplaaglaralpgaplgfirkrr
00503491   1/1  lar..elaedlalllveveglkpdvvvgiprgGvplaaalaralglplvlvrklgvlgitfyrdeqkllg
00365601   1/1  llswevikalirelaeeiaedykdgvepdvivgvlrgGlpfaallarelgvplavdrkrvksygg.....
00513011   1/1  llspedileairllaeeiaedlggkpdvvvgvlrgGvplaaalaralglplavgfkrrksygddlstlge
00470301   1/1  --rcifedlyfarpdsffdgpvvylllarllaelarel.dleadvvvgvplggiplAaalaralgiplai
00511051   1/1  lgrllvyealrilpleeievetplgatligellkdlkklvvvsilrgGlplaaglarllpsapvgfilir
00468521   1/1  ylgyarqdrkclpgepisaklvalllylagldrlltsdkhsgqlqlalisaeeileairelaeeieddig
00521141   1/1  -------------------dlendvvvgpdrggvpraaaladalglplavvlkrrkragvvpilragllr
00498331   1/1  ---------------------d.dvvvgvdrggvplaagladllglplavlrkrry............ed
00425361   1/1  llseeqiqgfidiladelaedyllldyiglepdvvvgvlrgGvvfaadlaralgllg........lplpl
00504351   1/1  lLeaagadrvltldlhrggvpvaaeiagfldipldlllarkilapyldelv..lvaialggvvv...lsp
00463501   1/1  -----------------------ndvvvgpddggvpraalladrlglplavilkrr............rs


                         +         -         -         -         -         *         -:210
query           GSASLEAHTDSLGPGDNVLLVDDLLATGGTAKASCELVESLGATVAACAFVIELDFLHGRERLSDYTVHS
00511631   1/1  srleygvdllllsldallkgkrVlivDDvlatGgTllaaiellkeaGakvvgvavlidkpelggreklvg
00469091   1/1  rlenvegalklpkdalvkgkrVllVDDvlaTGgTllaaaellkeaGakvvgvavlvdrpegggrelleea
00489191   1/1  plvivrkrrklpgttvviellyryeleygavtlelklgalvkgkrVllvDDvlaTGgTalaaaellkeaG
00419911   1/1  lenlkvalelslgadvegkrVllVDDvlaTGgTlraaaelLkeaGakvvgvavlvdkpeggarlrlegvd
00403561   1/1  gldvafelklpadvkgkrVllvDDvlaTGgTllaaielLkeaGakvvgvavladrpllslggrerlveag
00416871   1/1  rstgvleillilgalvegkrVllVDDviatGgTlraaielLreaGakvvgvavlvdkpggrellilpdvp
00482491   1/1  lplvivrkkrklpgtrvtieglylselergpnllllklpalvkgkrVllvDDvltTGgTalaaaelLkea
00517551   1/1  ......ghgeveliegalvkgkrVlivDDvitTGgTllaaaellkeaGaevvgvavlvdllsggarerle
00501361   1/1  sysrdygvggalellkgllgdvegkrVllVDDvittGgTlraaaelLkeaGakvvgvavlvdk..pegr.
00357911   1/1  vgrtliegnvilrlrldgdvkGkrVllVDDvidTGgTlraaaelLreaGakvvgvavlvdkpsgravdil
00369001   1/1  ekgvrlkllpldadvkgkrVllVDDviatGgTlraaielLreaGAkvvgvavlvdkpsgpafegidlsg-
00473091   1/1  lpglgpvleylllpgdv..........egrrVllvDDvlaTGgTllaaieaLkeaGakvvgvavlvd..a
00486781   1/1  detr.elgvvrlleglpadvkgkrVllVDDviaTGgTlraaielLreaGakvvgvavlvdkpegraleil
00354681   1/1  ek..........tlepvlyylklpgdv..kgrrVllvDdmlaTGgTllaAielLkelGakvvriavlhll
00348511   1/1  rgegnliigfdlpgdvkgkrVllVDDviaTGgTlraaidlLkeagrakvvgvavlvdkp..egrkrlrad
00419971   1/1  rgvpfvfirkerk............eygevvllig...lvkgkrVllVDDvittGgTlraaaelLreaGa
00415761   1/1  tgnvklvldldadvegkrvliVDDiidTGgTllaaaellkeagakvvgvavlldkppdyagerlpdef--
00461551   1/1  lplviirkvgklprvtvtisqsslygktrsegvvvilldldgdlkGkhVllVDDvidTGgTlaaaaelLk
00380171   1/1  geleil.....ldlrgdvkgkrVllVDDvidtGgTlraaaelLkeagakvvgvavlldkpsgraverlpd
00501511   1/1  ggvvlllnldgdvkgkrvllVDDvidTGgTlraaaelLkeagakvvkvavlvdkpsgparpdlygidipe
00501051   1/1  k............eyglgpvliyldlpgdvegrrVllvDDvlaTGgTllaaaelLkeaGakvvivavlva
00443341   1/1  lgerlkllrlpadlkgkrVllVDDvidTGgTlraaielLreaGrakvvgvavlvdrp..egra-------
00385881   1/1  errgnvkilkdlpgdvegkrVllVDDvidTGgTlraaaelLkeagakvvgvavlvdkpsggaelklkp--
00414891   1/1  ylegglsrlerlknvlgafklpadlkgkrVllVDDvitTGgTlraaielLreaGrakvvgvavlvdkp.e
00484931   1/1  kgatl....gpvleygklpgdv......kgkrVllvDDviaTGgTllaaielLkeaGakvvivavlvar.
00503491   1/1  rgavleglklpfdvegkrVllVDDvltTGgTlraaidaLreaGrakvvgvavlvdrp..egrkplapdyv
00365601   1/1  ...trstgelkilkdldgdlegkkVLiVDDiidtGgTllaaaelLkeagaksvkvavvll.d--------
00513011   1/1  verlkdlpg.....dvegkdVllVDDvidTGgTlraaaeaLkeagaksvkvavlvdkpegraleilpdyv
00470301   1/1  vlkrnryvgrtfirpsqelrekgvrvklnalvglveGkrVllVDDvittGtTlraaaeaLreaGAkevhv
00511051   1/1  rygetvvevllelepvlyylk....lpgdilkgknVllvDdmiaTGgTllaa------------------
00468521   1/1  pkplvvvgilrgGfnfaallaralglpliiilkvdllprvrltitqssyyrktrskgvvvilldldgdvk
00521141   1/1  ldgvllllsylrelerlgnveellrlvgdvkgrtVllVDDiidtGgTliaaaelLkeaGakevyvavthg
00498331   1/1  gvvrklnlvgdv.kgkrVllvDDiidtGgTllaaadaLreagAkevhaavlhpvlagpaverldgaaide
00425361   1/1  dfidksryggdtsslgnvvivkdligdvegkhVllVDDiidtGgTlraaaelLkeagaksvkvavlldkp
00504351   1/1  dlg.gvlrageldivly..rdyaeldkrrplvrevrlpgdvegktVllVDDvidTGgTlraaldaLrelg
00463501   1/1  lgvvrklnivgdv.kgkrvllvDDiidtGgTllaaaeaLreagAkevha---------------------


                         -         -         -         +         -         -         -:280
query           LVHY------------------------------------------------------------------
00511631   1/1  agvp------------------------------------------------------------------
00469091   1/1  g---------------------------------------------------------------------
00489191   1/1  akvvg-----------------------------------------------------------------
00419911   1/1  veslv-----------------------------------------------------------------
00403561   1/1  vdv-------------------------------------------------------------------
00416871   1/1  vis-------------------------------------------------------------------
00482491   1/1  Ga--------------------------------------------------------------------
00517551   1/1  dag-------------------------------------------------------------------
00501361   1/1  .---------------------------------------------------------------------
00357911   1/1  pdy-------------------------------------------------------------------
00369001   1/1  ----------------------------------------------------------------------
00473091   1/1  peg-------------------------------------------------------------------
00486781   1/1  pdyv------------------------------------------------------------------
00354681   1/1  asg-------------------------------------------------------------------
00348511   1/1  yv--------------------------------------------------------------------
00419971   1/1  kvvg------------------------------------------------------------------
00415761   1/1  ----------------------------------------------------------------------
00461551   1/1  k---------------------------------------------------------------------
00380171   1/1  yvg-------------------------------------------------------------------
00501511   1/1  livy------------------------------------------------------------------
00501051   1/1  ..a-------------------------------------------------------------------
00443341   1/1  ----------------------------------------------------------------------
00385881   1/1  ----------------------------------------------------------------------
00414891   1/1  gr--------------------------------------------------------------------
00484931   1/1  .peg------------------------------------------------------------------
00503491   1/1  gle-------------------------------------------------------------------
00365601   1/1  ----------------------------------------------------------------------
00513011   1/1  g---------------------------------------------------------------------
00470301   1/1  avlvp-----------------------------------------------------------------
00511051   1/1  ----------------------------------------------------------------------
00468521   1/1  g---------------------------------------------------------------------
00521141   1/1  ll--------------------------------------------------------------------
00498331   1/1  lvvt------------------------------------------------------------------
00425361   1/1  s---------------------------------------------------------------------
00504351   1/1  aksvva----------------------------------------------------------------
00463501   1/1  ----------------------------------------------------------------------