[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA56724.1


[Show Plain Result]

## Summary of Sequence Search
   1::270
   2::177    8e-36 35.9% 0051400 00514001 1/2   nese/Cell cycle control phosphatase     
 140::269  1.4e-33 35.9% 0049841 00498412 2/2   nese/Cell cycle control phosphatase     
 134::271  6.2e-33 29.6% 0049169 00491692 2/2   nese/Cell cycle control phosphatase     
 148::269  7.3e-33 38.5% 0041897 00418972 2/2   nese/Cell cycle control phosphatase     
 133::270  3.2e-32 33.1% 0046433 00464332 2/2   nese/Cell cycle control phosphatase     
 141::260  3.2e-32 38.5% 0049980 00499802 2/2   nese/Cell cycle control phosphatase     
 144::269  9.7e-32 38.5% 0044241 00442412 2/2   nese/Cell cycle control phosphatase     
   4::143  1.4e-31 34.1% 0044241 00442411 1/2   nese/Cell cycle control phosphatase     
   2::145  4.3e-31 33.3% 0041896 00418961 1/2   nese/Cell cycle control phosphatase     
 136::268  7.4e-31 38.7% 0046432 00464322 2/2   nese/Cell cycle control phosphatase     
 147::270  3.2e-30 36.7% 0041896 00418962 2/2   nese/Cell cycle control phosphatase     
 137::268  2.7e-28 32.8% 0049168 00491682 2/2   nese/Cell cycle control phosphatase     
   4::127  4.3e-28 36.3% 0046432 00464321 1/2   nese/Cell cycle control phosphatase     
  10::133    5e-28 34.4% 0041897 00418971 1/2   nese/Cell cycle control phosphatase     
   3::133  5.9e-27 33.6% 0049168 00491681 1/2   nese/Cell cycle control phosphatase     
   6::141    5e-26 34.1% 0049979 00499791 1/2   nese/Cell cycle control phosphatase     
   3::117  1.9e-25 35.8% 0049980 00499801 1/2   nese/Cell cycle control phosphatase     
 143::263  2.2e-25 34.5% 0049979 00499792 2/2   nese/Cell cycle control phosphatase     
   2::127  2.4e-25 34.7% 0049841 00498411 1/2   nese/Cell cycle control phosphatase     
 129::263  4.4e-25 33.1% 0038810 00388102 2/2   nese/Cell cycle control phosphatase     
 140::269    2e-24 36.4% 0043033 00430332 2/2   nese/Cell cycle control phosphatase     
 137::269  6.5e-24 32.8% 0044085 00440852 2/2   nese/Cell cycle control phosphatase     
   5::127  1.9e-23 37.3% 0049169 00491691 1/2   nese/Cell cycle control phosphatase     
 143::265  1.7e-22 42.0% 0051399 00513992 2/2   nese/Cell cycle control phosphatase     
 137::263  2.2e-22 39.4% 0043853 00438532 2/2   nese/Cell cycle control phosphatase     
 119::263  1.9e-21 30.4% 0042691 00426912 2/2   nese/Cell cycle control phosphatase     
 141::263  3.2e-21 38.1% 0046064 00460642 2/2   nese/Cell cycle control phosphatase     
   5::126  4.3e-21 34.2% 0046433 00464331 1/2   nese/Cell cycle control phosphatase     
 141::263  4.5e-21 38.3% 0050551 00505512 2/2   nese/Cell cycle control phosphatase     
 135::263  8.9e-20 37.1% 0051401 00514012 2/2   nese/Cell cycle control phosphatase     
   7::140  9.8e-20 30.3% 0046064 00460641 1/2   nese/Cell cycle control phosphatase     
   7::127  1.2e-19 32.5% 0038810 00388101 1/2   nese/Cell cycle control phosphatase     
   7::134  2.9e-19 33.6% 0043033 00430331 1/2   nese/Cell cycle control phosphatase     
   3::126    3e-19 34.8% 0044085 00440851 1/2   nese/Cell cycle control phosphatase     
 140::272  3.9e-19 34.3% 0038171 00381712 2/2   nese/Cell cycle control phosphatase     
   7::135  4.2e-19 33.0% 0043853 00438531 1/2   nese/Cell cycle control phosphatase     
 141::269  3.6e-18 33.0% 0051398 00513982 2/2   nese/Cell cycle control phosphatase     
   5::122  4.4e-18 35.0% 0051399 00513991 1/2   nese/Cell cycle control phosphatase     
   3::136  2.6e-17 32.1% 0050551 00505511 1/2   nese/Cell cycle control phosphatase     
   2::129  8.4e-17 33.3% 0038171 00381711 1/2   nese/Cell cycle control phosphatase     
   8::117  9.1e-17 30.3% 0042691 00426911 1/2   nese/Cell cycle control phosphatase     
   7::127  1.4e-16 33.3% 0051401 00514011 1/2   nese/Cell cycle control phosphatase     
   8::134  2.1e-16 27.5% 0051398 00513981 1/2   nese/Cell cycle control phosphatase     
 180::263  3.6e-15 34.3% 0051400 00514002 2/2   nese/Cell cycle control phosphatase     
   1::270


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAMFSLLLQPDELVRRLDEKNLLLIDLGSEESYLARHVPGAVHLDYTHIVAARPPVMGLLPDEHRLSRVL
00514001   1/2  -lssvplispaelaelladgdvvllDvrepaeyaaghipgAvnlpldella...................
00498412   2/2  ----------------------------------------------------------------------
00491692   2/2  ----------------------------------------------------------------------
00418972   2/2  ----------------------------------------------------------------------
00464332   2/2  ----------------------------------------------------------------------
00499802   2/2  ----------------------------------------------------------------------
00442412   2/2  ----------------------------------------------------------------------
00442411   1/2  ---llanlvllvsaeellallddgdvvllDvrepeelyagghIpgAvnipldalldd..dgrhtlpspee
00418961   1/2  -vvkmsllllvsaeelaalld..dvvlvDarsalrflgegpaeyraghIpgAvnlpldellddlllsspl
00464322   2/2  ----------------------------------------------------------------------
00418962   2/2  ----------------------------------------------------------------------
00491682   2/2  ----------------------------------------------------------------------
00464321   1/2  ---ftalldpvllvsaeelaallddgdvvllDvRspaeyagghipgAvnlpldelldrldelpgtlpspe
00418971   1/2  ---------aeellallddpdvvllDvrsaleflgeveegrplyraghIpgAvnipldelldd.sdldgt
00491681   1/2  --lpellpgplispeelaelldsglldpdvvllDvRsadrflgeepaeyaaghipgAvnipldtlldpdg
00499791   1/2  -----tvklispeellellddgdvvliDvRsalrdflglpepeeyaaghipgAinipldelldadgplph
00499801   1/2  --lpsllvsaeellellddgdvvllDvrspeeflgeveelraalraghipgAvnipldelld.....dgt
00499792   2/2  ----------------------------------------------------------------------
00498411   1/2  -lnpsllvsaeellellddgdvvllDvRspeeflgevllldpglglaayaaghipgAvnipldellda..
00388102   2/2  ----------------------------------------------------------------------
00430332   2/2  ----------------------------------------------------------------------
00440852   2/2  ----------------------------------------------------------------------
00491691   1/2  ----alvlaalnvvllispeelkellddgdvvliDvRspeeflglvpeprleelaaghipgAinipldel
00513992   2/2  ----------------------------------------------------------------------
00438532   2/2  ----------------------------------------------------------------------
00426912   2/2  ----------------------------------------------------------------------
00460642   2/2  ----------------------------------------------------------------------
00464331   1/2  ----sglltallsvvplispeelaallddgdvvllDvRspaefageglldlraghipgAinipldtlldg
00505512   2/2  ----------------------------------------------------------------------
00514012   2/2  ----------------------------------------------------------------------
00460641   1/2  ------llllllvlllllllvlallagvklispeelaellddglsdlledvvliDvRspeeyeggHipGA
00388101   1/2  ------pllalalvvallddvklispeellellesggedvlllDvRppeeYeggHIpgAiniplpelllr
00430331   1/2  ------vilvlllvgglaawlaaalpvvklispeelaellddgpdvvllDvRepeeyaaghipgAvnipl
00440851   1/2  --lpllsvvklispeelaellddg.vvllDvRepeeyagghipgAvniplgelle.....rglllspeel
00381712   2/2  ----------------------------------------------------------------------
00438531   1/2  ------iealssvklisaeelaellddgdvvlvDvRepeeyagghipgAinipl................
00513982   2/2  ----------------------------------------------------------------------
00513991   1/2  ----vplisaeelaallddgedvvllDvRepeefaaghipgavnipl.................delear
00505511   1/2  --llalivavaalagvplisaeeLkallddpndsvlllDvRspdeyekghIpgAvniplsqlllrrsdgt
00381711   1/2  -lsvvklispeelaellddgdavllDvRepeeyaaghipgAvnipl.................deleerl
00426911   1/2  -------mlvllikdllvllllllvspllsglkyispeelkallesglsslledvvliDvRspeeyeggH
00514011   1/2  ------llllllvlllllllllaalaavplisaeelaallddgdedvvllDvRepeeyaaghipgAvnip
00513981   1/2  -------lllalllvvplyfallaellagvptisaeelaallddgedavllDvRepeefaaghipgaini
00514002   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           SQLGFTPESHVVAYDAEGNGRASRLLWTLEELGHKHFSLLDGGLKAWLVEECPVKEGRESRQPSHFHGRY
00514001   1/2  rllgldkdkpvvvycg.sgvraaraawllralGfdnvyvLdGGlaaWkaaglpvetgvplpaplllfvvl
00498412   2/2  ---------------------------------------------------------------------l
00491692   2/2  ---------------------------------------------------------------alvlaal
00418972   2/2  ----------------------------------------------------------------------
00464332   2/2  --------------------------------------------------------------sglltall
00499802   2/2  ----------------------------------------------------------------------
00442412   2/2  ----------------------------------------------------------------------
00442411   1/2  laallgelgidkdkpvvvycgsglvrAaraawalrllGyknvrvldGGlsaWlaaglpvetgvpvpspgt
00418961   1/2  dgtlpspeelaallgelgidkdkpvvvycgsgglvrAaraawalrllGh.dvyvLdGGwsaWkaaglpve
00464322   2/2  -----------------------------------------------------------------ftall
00418962   2/2  ----------------------------------------------------------------------
00491682   2/2  ------------------------------------------------------------------lpel
00464321   1/2  elaallgalgidkdkpvvvydcgsgvraaraawllrllGfenvyvldGGlsaWlaag-------------
00418971   1/2  lpspeelaellgalgidndeeadlkpvvvycg.sgvrAaraawalrllGhenvrlldGGwseW-------
00491681   1/2  plphllpspeelaellaelgidkdkpvvvycrsslgvrlaaraalllralGfenvyvLdGGls-------
00499791   1/2  mlpsaeeleellaelgidkdkpivvyCgsgvrssaraalalrllGfknvyvLdGGikaWlaaglpvetge
00499801   1/2  lpspeelaallaelgidkdkpvvvycg.sgvraaraalalrllGyen-----------------------
00499792   2/2  ----------------------------------------------------------------------
00498411   1/2  ..dgtlpspeelaellaelgidkdkpvvvycgs.gvrsalaalallrllGyenvrvl-------------
00388102   2/2  ----------------------------------------------------------pllalalvvall
00430332   2/2  ---------------------------------------------------------------------v
00440852   2/2  ------------------------------------------------------------------lpll
00491691   1/2  ldd....dgtlpspeeleellselgidkdkpivvyCg.sgvrsaraalalkelGfkn-------------
00513992   2/2  ----------------------------------------------------------------------
00438532   2/2  ------------------------------------------------------------------ieal
00426912   2/2  ------------------------------------------------mlvllikdllvllllllvspll
00460642   2/2  ----------------------------------------------------------------------
00464331   1/2  d....glllspeelaellaelgldkdkpvvvycr.sgvrsaraalllrelGfenvy--------------
00505512   2/2  ----------------------------------------------------------------------
00514012   2/2  ----------------------------------------------------------------llllll
00460641   1/2  inipldeller............llelllallgldkdkpvvvyCefsgvrsakaarlLrkllralnlypl
00388101   1/2  rlkfdllllllllspeeleell..lgldkdkpvvvyc.esgsrsapalasllrllla-------------
00430331   1/2  gel..............eeflaelaalgidkdkpvvvycrs.gvrsaraalllrelGfenvynl------
00440851   1/2  eallg..gldkdkpvvvyc.rsgvrsaraalllrelGfenvylldGGllaWlaagl--------------
00381712   2/2  ---------------------------------------------------------------------l
00438531   1/2  .deleerlgellpgidkdkpvvvycgsgvrsgpklarllraraalalralGyknvyvLdGGfsaW-----
00513982   2/2  ----------------------------------------------------------------------
00513991   1/2  laelgidkdkpvvvycgsgv.rsaraalllralGyenvyvldgGlsaWlaag------------------
00505511   1/2  ..leslleleellallgidkdkpvvlycgsg.vraalaldstlrllalalkllgyktllrsdvyvL----
00381711   1/2  gel..dkdkpvvvyc.rsgvrsalaalllrelGfenvyvldgGilaWlaaglplvsglp-----------
00426911   1/2  ipgAiniplseller...........elletllalleldkdkpivvy-----------------------
00514011   1/2  l.................gelearlgelgidkdkpivvycr.sgvrsalaaalLrel-------------
00513981   1/2  pl.................gelearlaellpdkdkpivvycasg.vrsalaaalLrkaGfdnlv------
00514002   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           QGHQAADKEYILAHLLDPKVVILDARSPAEYHGEYVRAQRGGHIPGAVNFEWTQAIDQERNLRFKPMDEL
00514001   1/2  lagllvltaeellallldgevvlldarsadeflgghi---------------------------------
00498412   2/2  npsllvsaeellellddgdvvllDvRspeeflgevllldpglglaayaaghipgAvnipldellda..dg
00491692   2/2  nvvllispeelkellddgdvvliDvRspeeflglvpeprleelaaghipgAinipldelldd..dgtlps
00418972   2/2  -------aeellallddpdvvllDvrsaleflgeveegrplyraghIpgAvnipldellddsdldgtlps
00464332   2/2  svvplispeelaallddgdvvllDvRspaefageglldlraghipgAinipldtlldg..dglllspeel
00499802   2/2  lpsllvsaeellellddgdvvllDvrspeeflgeveelraalraghipgAvnipldelld...dgtlpsp
00442412   2/2  ---llanlvllvsaeellallddgdvvllDvrepeelyag........ghIpgAvnipldalldddgrht
00442411   1/2  fla-------------------------------------------------------------------
00418961   1/2  tgvpl-----------------------------------------------------------------
00464322   2/2  dpvllvsaeelaallddgdvvllDvRspaeyag........ghipgAvnlpldelldrldelpgtlpspe
00418962   2/2  ------vvkmsllllvsaeelaall.d.dvvlvDarsalrflgegpaeyraghIpgAvnlpldellddll
00491682   2/2  lpgplispeelaelldsglldpdvvllDvRsadrflgeepaeyaaghipgAvnipldtlldpdgplphll
00464321   1/2  ----------------------------------------------------------------------
00418971   1/2  ----------------------------------------------------------------------
00491681   1/2  ----------------------------------------------------------------------
00499791   1/2  p---------------------------------------------------------------------
00499801   1/2  ----------------------------------------------------------------------
00499792   2/2  --tvklispeellellddgdvvliDvRsalrdflglpepeey........aaghipgAinipldelldad
00498411   1/2  ----------------------------------------------------------------------
00388102   2/2  ddvklispeellellesggedvlllDvRppeeYeg........gHIpgAiniplpelllrrlkfdlllll
00430332   2/2  ilvlllvgglaawlaaalpvvklispeelaellddgpdvvllDvRepeeyaa........ghipgAvnip
00440852   2/2  svvklispeelaellddg.vvllDvRepeeyag........ghipgAvniplgelle...rglllspeel
00491691   1/2  ----------------------------------------------------------------------
00513992   2/2  --vplisaeelaallddgedvvllDvRepeefaa........ghipgavnipl...............de
00438532   2/2  ssvklisaeelaellddgdvvlvDvRepeeyag........ghipgAinipl...............del
00426912   2/2  sglkyispeelkallesglsslledvvliDvRspeeyeg........gHipgAiniplseller......
00460642   2/2  llllllvlllllllvlallagvklispeelaellddglsdlledvvliDvRspeeyeg........gHip
00464331   1/2  ----------------------------------------------------------------------
00505512   2/2  llalivavaalagvplisaeeLkallddpndsvlllDvRspdey........ekghIpgAvniplsqlll
00514012   2/2  vlllllllllaalaavplisaeelaallddgdedvvllDvRepeeyaa........ghipgAvnipl...
00460641   1/2  ----------------------------------------------------------------------
00388101   1/2  ----------------------------------------------------------------------
00430331   1/2  ----------------------------------------------------------------------
00440851   1/2  ----------------------------------------------------------------------
00381712   2/2  svvklispeelaellddgdavllDvRepeeyaa........ghipgAvnipl...............del
00438531   1/2  ----------------------------------------------------------------------
00513982   2/2  lllalllvvplyfallaellagvptisaeelaallddgedavllDvRepeefaa........ghipgain
00513991   1/2  ----------------------------------------------------------------------
00505511   1/2  ----------------------------------------------------------------------
00381711   1/2  ----------------------------------------------------------------------
00426911   1/2  ----------------------------------------------------------------------
00514011   1/2  ----------------------------------------------------------------------
00513981   1/2  ----------------------------------------------------------------------
00514002   2/2  ---------------------------------------aaghipgAvnlpldella.............


                         -         -         -         +         -         -         -:280
query           RSSLEALGITPDKEVICYCQTHHRSAHTCMVLKYLGYPKIKGYPGSWSEWGNAPDTPIKV----------
00514001   1/2  ----------------------------------------------------------------------
00498412   2/2  tlpspeelaellaelgidkdkpvvvycgsgvrsalaalallrllGyenvrvldGGwsaW-----------
00491692   2/2  peeleellselgidkdkpivvyCgsgvrsaraalalkelGfknvyvldGGilaWlaa.glp---------
00418972   2/2  peelaellgalgidndeeadlkpvvvycgsgvrAaraawalrllGhenvrlldGGwseW-----------
00464332   2/2  aellaelgldkdkpvvvycrsgvrsaraalllrelGfenvyvldGGlsaWlaavglpvel----------
00499802   2/2  eelaallaelgidkdkpvvvycgsgvraaraalalrllGyenvrvldGGl--------------------
00442412   2/2  lpspeelaallgelgidkdkpvvvycgsglvrAaraawalrllGyknvrvldGGlsaWl-----------
00442411   1/2  ----------------------------------------------------------------------
00418961   1/2  ----------------------------------------------------------------------
00464322   2/2  elaallgalgidkdkpvvvydcgsgvraaraawllrllGfenvyvldGGlsaWlaa.g------------
00418962   2/2  lsspldgtlpspeelaallgelgidkdkpvvvycgsgglvrAaraawalrllGh.dvyvL----------
00491682   2/2  pspeelaellaelgidkdkpvvvycrsslgvrlaaraalllralGfenvyvLdGGlsa------------
00464321   1/2  ----------------------------------------------------------------------
00418971   1/2  ----------------------------------------------------------------------
00491681   1/2  ----------------------------------------------------------------------
00499791   1/2  ----------------------------------------------------------------------
00499801   1/2  ----------------------------------------------------------------------
00499792   2/2  gplphmlpsaeeleellaelgidkdkpivvyCgsgvrssaraalalrllGfkn-----------------
00498411   1/2  ----------------------------------------------------------------------
00388102   2/2  lllspeeleell..lgldkdkpvvvycesgsrsapalasllrlllaalalkkl-----------------
00430332   2/2  lgel............eeflaelaalgidkdkpvvvycrsgvrsaraalllrelGfenv-----------
00440852   2/2  eallg..gldkdkpvvvycrsgvrsaraalllrelGfenvylldGGllaWlaaglplvk-----------
00491691   1/2  ----------------------------------------------------------------------
00513992   2/2  learlaelgidkdkpvvvycgsgvrsaraalllralGyenvyvldgGlsaWlaag---------------
00438532   2/2  eerlgellpgidkdkpvvvycgsgvrsgpklarllraraalalralGyknvyv-----------------
00426912   2/2  ...elletllalleldkdkpivvyCefsgvrsakaaalLreldralnlypklG-----------------
00460642   2/2  GAinipldeller..........llelllallgldkdkpvvvyCefsgvrsak-----------------
00464331   1/2  ----------------------------------------------------------------------
00505512   2/2  rrsdgtleslleleellallgidkdkpvvlycgsgvraalaldstlrllalal-----------------
00514012   2/2  ............gelearlgelgidkdkpivvycrsgvrsalaaalLrelGf.-----------------
00460641   1/2  ----------------------------------------------------------------------
00388101   1/2  ----------------------------------------------------------------------
00430331   1/2  ----------------------------------------------------------------------
00440851   1/2  ----------------------------------------------------------------------
00381712   2/2  eerlgel..dkdkpvvvycrsgvrsalaalllrelGfenvyvldgGilaWlaaglplvsglp--------
00438531   1/2  ----------------------------------------------------------------------
00513982   2/2  ipl...............gelearlaellpdkdkpivvycasgvrsalaaalLrkaGfd-----------
00513991   1/2  ----------------------------------------------------------------------
00505511   1/2  ----------------------------------------------------------------------
00381711   1/2  ----------------------------------------------------------------------
00426911   1/2  ----------------------------------------------------------------------
00514011   1/2  ----------------------------------------------------------------------
00513981   1/2  ----------------------------------------------------------------------
00514002   2/2  ....rllgldkdkpvvvycgsgvraaraawllralGfdnvyvLdGGlaaWkaa-----------------