[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA56789.1


[Show Plain Result]

## Summary of Sequence Search
   1::307
 101::294  4.2e-37 34.3% 0038243 00382431 1/1   thione synthetase ATP-binding domain-li 
  92::296  3.5e-33 34.0% 0035215 00352151 1/1   thione synthetase ATP-binding domain-li 
 103::290  2.5e-29 28.3% 0044272 00442721 1/1   thione synthetase ATP-binding domain-li 
  92::294  3.6e-25 25.3% 0047322 00473221 1/1   thione synthetase ATP-binding domain-li 
 103::290    5e-19 24.2% 0047408 00474081 1/1   thione synthetase ATP-binding domain-li 
 102::290  5.3e-19 25.3% 0046457 00464571 1/1   thione synthetase ATP-binding domain-li 
 103::289  2.6e-18 23.5% 0044434 00444341 1/1   thione synthetase ATP-binding domain-li 
 102::301  6.5e-18 22.5% 0036618 00366181 1/1   thione synthetase ATP-binding domain-li 
 101::300  7.2e-18 23.6% 0046656 00466561 1/1   thione synthetase ATP-binding domain-li 
 102::295  1.9e-15 22.2% 0037006 00370061 1/1   thione synthetase ATP-binding domain-li 
 102::301  2.2e-15 22.5% 0038251 00382511 1/1   thione synthetase ATP-binding domain-li 
  72::291  9.6e-13 23.6% 0050408 00504081 1/1   thione synthetase ATP-binding domain-li 
 102::300  4.2e-11 23.9% 0044852 00448521 1/1   thione synthetase ATP-binding domain-li 
  99::306  1.8e-10 18.8% 0045447 00454471 1/1   thione synthetase ATP-binding domain-li 
 102::299  9.3e-10 22.8% 0035376 00353761 1/1   thione synthetase ATP-binding domain-li 
 105::297  1.5e-07 22.3% 0034972 00349721 1/1   thione synthetase ATP-binding domain-li 
 130::226  8.7e-05 26.9% 0053122 00531221 1/1   thione synthetase ATP-binding domain-li 
   1::307


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLRIVIFNNSHGWHSKQLEAALAPQGVAIIRSNLAQCRIDLDSPSGLHIPGLGGDLPDAAIVRGIAAGSF
00382431   1/1  ----------------------------------------------------------------------
00352151   1/1  ----------------------------------------------------------------------
00442721   1/1  ----------------------------------------------------------------------
00473221   1/1  ----------------------------------------------------------------------
00474081   1/1  ----------------------------------------------------------------------
00464571   1/1  ----------------------------------------------------------------------
00444341   1/1  ----------------------------------------------------------------------
00366181   1/1  ----------------------------------------------------------------------
00466561   1/1  ----------------------------------------------------------------------
00370061   1/1  ----------------------------------------------------------------------
00382511   1/1  ----------------------------------------------------------------------
00504081   1/1  ----------------------------------------------------------------------
00448521   1/1  ----------------------------------------------------------------------
00454471   1/1  ----------------------------------------------------------------------
00353761   1/1  ----------------------------------------------------------------------
00349721   1/1  ----------------------------------------------------------------------
00531221   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EQITLRLDVLHTLAEFGIPVLNTASAIERTVDKARTSLLLRHRRVPTPRAWACEDLAQARHLSAQAQREK
00382431   1/1  ------------------------------gdKl....llakaglpvPptlvasdleealefleelg...
00352151   1/1  ---------------------nspeaialamdKlltkkllaklqkklglagvpvpptsiled......ak
00442721   1/1  --------------------------------Kllakellakagipvpptlvatsleealaaaee...ig
00473221   1/1  ---------------------NspeairlagdKllakellaka.iptppglplptllvtsleeal...ef
00474081   1/1  --------------------------------Kllakqllaeagipvppgvlvtssdlllldleeal...
00464571   1/1  -------------------------------DKlltklllaeagipvppgvlvtsleea.....aaeelg
00444341   1/1  --------------------------------Kllakellakagipvppgllavatsleealaaaeelg.
00366181   1/1  -------------------------------DKllakellakagipvppglllavvtsleealaaaeeig
00466561   1/1  ------------------------------gDKllakellaeagiptppyalvtsleea...leaaeeig
00370061   1/1  -------------------------------DKvlakellakagipvppgvvltsleellllaleaaeel
00382511   1/1  -------------------------------DKllakellakagiptppggvatsveealaaaeeig...
00504081   1/1  -Gflienailaqvlevagipl.........agdkvlakellkkagipvaPdllyegavvtsleeal...e
00448521   1/1  -------------------------------dkylakellkkagiptpkgavatspeealeaaeeigyP.
00454471   1/1  ----------------------------laldkyeakellakagipvppggvatspeeaveaaeei...g
00353761   1/1  -------------------------------Dkllakelleklglptapyalvdslee...llaaaeelg
00349721   1/1  ----------------------------------lfkelleelgiptpkyavatsleeal...aaaeeig
00531221   1/1  -----------------------------------------------------------tyleltdyllk


                         +         -         -         -         -         *         -:210
query           RELVLKPLFGCQGQGIIRIGKPADLEACEPTGGLYYLQEFIRPAQPNIWQDWRVFVIGHRPIAAMVRRGQ
00382431   1/1  .pvvlKpldgsgGrgvflvededelldaleelltlsgngpvlvqeylpgi...kegdirvlvvggevvaa
00352151   1/1  elaeklgyPvvvKplyggsGkgvvkveneeeledalelaalldspvlveefidgg.....rdirvqvlgd
00442721   1/1  yPvvvKplygggGrgvrlvrdeeeleaaleealeeaasgdgpvlveeflegpe....reirvlvvgdevv
00473221   1/1  aeelgyPvvvKpaggggGkGvrivkneeeleaaleealseddpvlveefiegp.....reirvlvlgdgv
00474081   1/1  aaaeelgyPvvvKpaaggggkGvsvvrneeeleealelalegddevlvEefiegr......eievlvlgd
00464571   1/1  yPvvvKparggggkGvsivrseeeleaaleealegddevlvEefie......greievlvlgdggevvvl
00444341   1/1  ..yPvvvKpagggggrGvrvvkseeeleealeealgealagfgddpvlvEefle.....gareievlvlg
00366181   1/1  ...yPvvvKpaggggGkGvrvvrdeeeleealeealeealagsgdgpvlveeflega.....reievlvl
00466561   1/1  yPvvvKpaggggGkGvrvvrseeeleaaleealeeslfgdgevlvEefiega.....reisvlvlrdgdg
00370061   1/1  gyPvvvKpaagggGkGvsvvkneeeleealeeaffydsevlvEefiega.....rEievqvlgdgkgnvv
00382511   1/1  yPvvvKpsggggGkGvrvvrseeeleealeealgealagsgdgevlvEefleg......reisvlvlgdg
00504081   1/1  aaeeigyPvvvKpsrggggrGvrivkseeeleaaleealaespgspvlveefie.....gareyevdvla
00448521   1/1  ..vvvKpsggagGrGvvvvkseeeleealeealgealvgsgdgpvlvEefl.....eg.rEisvlvlrdg
00454471   1/1  yPkvVvKasvglgGrgkaGGvrlvkseeeleeaaeellgevlvtlqtalagspvdgvlveefl.....dg
00353761   1/1  yPvvvKparggYgGkgvsvvkseeeleaalegdgevlvEefve.....gdreisvlvlrdgdgevvfypl
00349721   1/1  yPvvvKp.......Gvsvvyneeeleeal..dhpvlveeflega.....kEvsvdvvrdgggvvilgiie
00531221   1/1  ndlVlKPvlgrgGagvli..pdasgeeleealgkyleepyIaQellelpkfggryvllgsflvggepaGl


                         -         -         -         +         -         -         -:280
query           GWITNVARGAQYFPAPLEREIGALACQATQAVAVDYGGVDIIQTPAQGFQVLEVNSIPSWKALQQTTEVN
00382431   1/1  ilrrvpaggdfrsnlalggsaeaaplteelrelalkaaralkelglgfvgvDii.....gpyvlEvNvrs
00352151   1/1  kvvaavrriiegdwkanvh.ggslepaplseelrelalkaakalgglglagvdflvdkdgelyvlEvNtr
00442721   1/1  aavirrhgdviaevhaggsalvaplteelrelalkaakalglglagvdflvd.dgelyvlEvNprpgvtg
00473221   1/1  lpaierspeggflsntggpaalspelleeireialkaakalgyrgllgvdflldkdgepyllEvNprpgl
00474081   1/1  gvlpvvelvdpkgfydgdakyrtggvievapap.lsdelleeirelalkaakalglrgllgvdflldedg
00464571   1/1  pvveiipgngiydgeakyslgrrhqksievapaplsdelleelrelalkaakalglrglarvdffvdedg
00444341   1/1  dgegavvllgerdesagvhtggvieeapaptlseelleeirelalkaakalgyrGllgvdflvdedgely
00366181   1/1  gdgegvvillgerdhdagvhtggsieeapaptlseelleeirelalkaaralgyvGllgveflvd.dgel
00466561   1/1  vvifevdenvqrngvhsgevapaplsdelleelreialkaaralgyvgllgveffvd.dgelyviEvnpr
00370061   1/1  vlgerecslqrrhqkfydyeakyhtggsieeappadlsdelreeirelavkaakalgyrglarvdfllde
00382511   1/1  ggvvvlavaerhqkvgiedagvhtggsgavapaptltdelleeireiavkptldglaakalgyvgvlgve
00504081   1/1  dgdgevvalgirecsvgihtgdsievapaltlpdelleelreaalklakalglvgaggveflvdpkdgep
00448521   1/1  egvvvliiasdhggvyiedvgvntggsiavapap.lseelleeireialkiakalgleglayvgllgvef
00454471   1/1  arElyvgvvrdrvfgnvvllgsmeGGvdiesvgrhsgdlievapadaltgllrerarelalklglalgyv
00353761   1/1  veniqrngilvgsvaPaplsdelleeareialkiaealgyvGvlgveffvtgdg.llvnEvnprphnsgh
00349721   1/1  hieeagvhtgdsgvvlppatlsdelleelreiakkiaralglrGllnvdffvt.ddevyviEvNprpsrt
00531221   1/1  glRedtglitgnl..S------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           IAGALAKNLLERLHSSYFAHSGSSQKI-------------------------------------------
00382431   1/1  ppgflgielatgid--------------------------------------------------------
00352151   1/1  pgleglv..tgidlak------------------------------------------------------
00442721   1/1  pekatgidla------------------------------------------------------------
00473221   1/1  glvehppleaalgi--------------------------------------------------------
00474081   1/1  epyvlEvNtr------------------------------------------------------------
00464571   1/1  evyvlEvNpr------------------------------------------------------------
00444341   1/1  viEvNprpg-------------------------------------------------------------
00366181   1/1  yvlEvNprpgvtgpvtekatg-------------------------------------------------
00466561   1/1  pgvtgpvtlkatgidlaela--------------------------------------------------
00370061   1/1  dgepyviEvNtrpgv-------------------------------------------------------
00382511   1/1  flldkdgepyviEvNprpgdp-------------------------------------------------
00504081   1/1  yvlEvNpRpgg-----------------------------------------------------------
00448521   1/1  llt.dgepyvlEiNprpgdt--------------------------------------------------
00454471   1/1  galadlllnvefllvd.gdlyvlEiN--------------------------------------------
00353761   1/1  vtllatgislfelhlraal---------------------------------------------------
00349721   1/1  vplvskatgvslaelal-----------------------------------------------------
00531221   1/1  ----------------------------------------------------------------------