[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA56844.1


[Show Plain Result]

## Summary of Sequence Search
   1::276
   1::276  5.1e-58 29.2% 0044048 00440481 1/1   nopimelate epimerase-like               
 133::276  2.1e-52 49.3% 0046029 00460292 2/2   nopimelate epimerase-like               
   3::132  1.1e-49 50.0% 0046028 00460281 1/2   nopimelate epimerase-like               
   1::276  1.5e-42 29.2% 0043521 00435211 1/1   nopimelate epimerase-like               
 141::275  2.5e-26 24.2% 0043560 00435602 2/2   nopimelate epimerase-like               
   5::131  3.7e-26 32.2% 0043560 00435601 1/2   nopimelate epimerase-like               
 128::277  6.8e-17 25.0% 0049758 00497581 1/1   nopimelate epimerase-like               
 133::276  1.8e-08 24.6% 0051111 00511111 1/1   nopimelate epimerase-like               
   4::130  2.5e-06 31.4% 0044177 00441771 1/2   nopimelate epimerase-like               
  59::134  2.8e-06 33.3% 0051110 00511101 1/2   nopimelate epimerase-like               
 119::276  3.5e-06 21.8% 0049368 00493681 1/1   nopimelate epimerase-like               
  62::132  3.4e-05 24.3% 0046029 00460291 1/2   nopimelate epimerase-like               
 200::275      1.7 26.4% 0051110 00511102 2/2   nopimelate epimerase-like               
 203::276      1.9 23.3% 0046028 00460282 2/2   nopimelate epimerase-like               
 197::266       13 27.5% 0044177 00441772 2/2   nopimelate epimerase-like               
   1::276


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRIAFTKMQGLGNDFVVIDALSQPLSLTASQVRWIANRRLGIGCDQVLLVTPASLPAIDFGYRIFNADGG
00440481   1/1  mrssvrlrvvdvhtgGnplrvvldgvpalpgglllekrqaiarldnlretlllePrGhgvmvgalllppt
00460292   2/2  ----------------------------------------------------------------------
00460281   1/2  --lkFtkmhglGNdfvvvdlrdllldltaeliaalcdrrfgigadglllvlpsldegadfrmrifnaDgs
00435211   1/1  melpfllvdaFtdepflGNpaaVvlladg...lsdelmqaiArel...nlsetafvlppd...adfrlri
00435602   2/2  ----------------------------------------------------------------------
00435601   1/2  ----lpllalklelmmlldvlvvdvFtdvhflGNPaaVvlladl...lsdelmqaiar...elnlsetaf
00497581   1/1  ----------------------------------------------------------------------
00511111   1/1  ----------------------------------------------------------------------
00441771   1/2  ---alkfylvdaFtdepfgGnpaaVvlladg...lsdalmqaiarel...nlsetaFvlppsdpa.dyrv
00511101   1/2  ----------------------------------------------------------dyrlriFtPtg.
00493681   1/1  ----------------------------------------------------------------------
00460291   1/2  -------------------------------------------------------------lrvyErGag
00511102   2/2  ----------------------------------------------------------------------
00460282   2/2  ----------------------------------------------------------------------
00441772   2/2  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           EVEQCGNGARCFARFVREQGLTDKNVLRVQTASGIIELQLETDGQITVDMGVPRFAPHQIPFKVDQEADY
00440481   1/1  dpdadagvlffnpdg.elpmcGhgtigvatallelGlvpkeepvgrlvletpaGlvevevevdggkvesv
00460292   2/2  --------------------------------------------------------------llgglelk
00460281   1/2  eaemCGNGtrcvarfllekglvgkdeitvetlaglllvtvlgdglvsvdmglprllpveiPl--------
00435211   1/1  FtPdg.evpfcGHatlaaaavllelgglpggtlvletkaGlltvrv.egglialdfplprllplllpael
00435602   2/2  ----------------------------------------------------------------------
00435601   1/2  vlppdda..dfrlriftpgg.evpfCGhgtlaaaaallelgllsggtltletpaGlltvel---------
00497581   1/1  ---------------------------------------------------------gdfp.slellaaa
00511111   1/1  --------------------------------------------------------------lleelaaa
00441771   1/2  riftpag.elpfcGhatlgaahallelgglvpdttlvleletgsgpvevrregdg.lvld----------
00511101   1/2  EvplaGhatlaaaavllelgll..gvlvletlaglltvel.dgglilldlpapllepllipell------
00493681   1/1  ------------------------------------------------eldlpallaaalgldlddllsg
00460291   1/2  eTlaCGtGacAaavaalllglldskv.tvllpgGlllilildddgsvlmtGpaelvfegeie--------
00511102   2/2  ----------------------------------------------------------------------
00460282   2/2  ----------------------------------------------------------------------
00441772   2/2  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           YSLELDGQQVEIGAVSMGNPHCVLRVPAVDTAPVAHWGPLLESHPRFPQRVNVGFAQIVSPGHLRLRVYE
00440481   1/1  tflnvpaflaaldvsvevp..........glgtvtvdivygGnpyavvdvadlglslelsnaaellalgp
00460292   2/2  llllvlgllllltavnvGnPHlvifvddldkldleklgpllenhplfPegvNvefvevldkneirlrvyE
00460281   1/2  ----------------------------------------------------------------------
00435211   1/1  adalgl...........pvlvstglphlvvvldsle..avlalrpdleallelplrvgvvvvalysdadf
00435602   2/2  lpllalklelmmlldvlvvdvFtdvhflGNPaaVvlladl...lsdelmqaiarelnlseta...fvlpp
00435601   1/2  ----------------------------------------------------------------------
00497581   1/1  lglalldllglppvvvstgldfllvll...sleallalrpdleal.klldglgvivtalfdlddfvsRvF
00511111   1/1  lglslddl..ppvvvstglpfllvplks..leallalrpdlaalaellllvvivta..gddadfvsRmFa
00441771   1/2  ----------------------------------------------------------------------
00511101   1/2  ----------------------------------------------------------------------
00493681   1/1  l.........ppvvvstglrfllvvleslea..llalrpdlealaelleelgvlgvivtalgdegadfvs
00460291   1/2  ----------------------------------------------------------------------
00511102   2/2  -----------------------------------------------------------dgadyrlriFt
00460282   2/2  --------------------------------------------------------------dfrmrifn
00441772   2/2  --------------------------------------------------------alkfylvdaFtdep


                         -         -         -         +         -         -         -:280
query           RGAGETPACGTGACAAAVIGKRRGWLSGQVNVDLPGGRLGIHWEGDGKSVWMSGPAEIVFKGSIEL----
00440481   1/1  airaalleqllvvhpedpllhnvyfvilvglldddedadernvvvfedgaidrsPcGtgtsArlAl----
00460292   2/2  rGageTlaCGtGacAaavaalllglldskvtvllpgGlllilildddgsvlmtGpaelvfegeiel----
00460281   1/2  ----------------------------------------------------------------------
00435211   1/1  vsRvfapglgvaeDpaTGsaaaalaaylaarllklllvqgqasgrgglllvevd..dgrvlvgGra----
00435602   2/2  ddadfrlriftpgg.evpfCGhgtlaaaaallelgllsggtltletpaGlltvellledglvtvd-----
00435601   1/2  ----------------------------------------------------------------------
00497581   1/1  palgilEDpaTGsaaaalapylaelglllgklelvaeQGvasgrgGlllvellgdg.rvlvgGravt---
00511111   1/1  palgipEDPaTGsaaaaLaaylaelllldgklslvieQGvamgrpglllvevdgdggeilrvlvgG----
00441771   1/2  ----------------------------------------------------------------------
00511101   1/2  ----------------------------------------------------------------------
00493681   1/1  RmFaPalgilEDPvTGsahaaLapyllwagllgkdegllrlvaeQGvasgrgglllvellgdggki----
00460291   1/2  ----------------------------------------------------------------------
00511102   2/2  Ptg.EvplaGhatlaaaavllelgll.gvlvletlaglltvel..dgglilldlpapllepllip-----
00460282   2/2  aDgseaemCGNGtrcvarfllekglvgkdeitvetlaglllvtvlgdg.lvsvdmglprllpveiP----
00441772   2/2  fgGnpaaVvlladglsdalmqaiarelnlsetaFvlppsdpadyrvriftp.agel--------------