[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA56902.1


[Show Plain Result]

## Summary of Sequence Search
   1::696
 448::684  2.5e-56 37.8% 0051946 00519461 1/1   omain-like                              
 275::433  1.3e-36 32.7% 0050343 00503431 1/1   otide cyclase                           
 131::257  1.2e-16 32.5% 0037219 00372191 1/1   ike sensor domain (PAS domain)          
 145::255  1.1e-15 31.2% 0050109 00501091 1/1   ike sensor domain (PAS domain)          
 149::257    2e-14 29.9% 0040536 00405361 1/1   ike sensor domain (PAS domain)          
 157::269  5.1e-14 31.2% 0046377 00463771 1/1   ike sensor domain (PAS domain)          
 130::253  3.4e-13 29.2% 0048459 00484591 1/1   ike sensor domain (PAS domain)          
 144::253  3.5e-12 29.2% 0048248 00482481 1/1   ike sensor domain (PAS domain)          
 151::257  6.1e-12 32.4% 0048715 00487151 1/1   ike sensor domain (PAS domain)          
 153::257  5.4e-11 31.1% 0046045 00460451 1/1   ike sensor domain (PAS domain)          
 150::253  5.6e-11 30.0% 0048644 00486441 1/1   ike sensor domain (PAS domain)          
 151::257  8.8e-11 27.6% 0041279 00412791 1/1   ike sensor domain (PAS domain)          
 154::255  2.4e-09 29.0% 0046903 00469031 1/1   ike sensor domain (PAS domain)          
 155::255  3.9e-09 28.3% 0048579 00485791 1/1   ike sensor domain (PAS domain)          
   2::138  4.8e-09 22.8% 0039925 00399251 1/1   like                                    
   8::149  1.6e-08 22.6% 0050342 00503421 1/1   like                                    
   6::136    4e-08 23.8% 0047753 00477531 1/1   like                                    
   7::129  4.3e-08 23.5% 0051573 00515731 1/1   like                                    
   4::138  4.8e-08 23.3% 0048066 00480661 1/1   like                                    
   8::129  7.1e-08 22.9% 0051574 00515741 1/1   like                                    
   8::149  1.2e-07 20.9% 0048975 00489751 1/1   like                                    
   8::166  1.4e-07 20.6% 0043525 00435251 1/1   like                                    
   8::137    2e-07 23.2% 0051860 00518601 1/1   like                                    
   9::132  2.2e-07 22.3% 0046299 00462991 1/1   like                                    
   7::127  2.5e-07 23.1% 0046428 00464281 1/1   like                                    
   7::130  2.9e-07 22.3% 0047799 00477991 1/1   like                                    
   8::139  3.2e-07 23.4% 0047296 00472961 1/1   like                                    
   8::149  3.2e-07 24.8% 0048465 00484651 1/1   like                                    
   6::128  3.3e-07 21.7% 0048231 00482311 1/1   like                                    
   7::148  3.3e-07 24.1% 0050341 00503411 1/1   like                                    
   5::143  3.4e-07 21.9% 0045700 00457001 1/1   like                                    
   7::129  4.1e-07 22.5% 0051386 00513861 1/1   like                                    
   8::129  4.2e-07 23.7% 0048463 00484631 1/1   like                                    
   5::129    8e-07 23.0% 0046294 00462941 1/1   like                                    
   5::129    1e-06 21.3% 0047867 00478671 1/1   like                                    
   6::129  1.1e-06 21.7% 0050964 00509641 1/1   like                                    
   7::127  1.1e-06 23.7% 0045852 00458521 1/1   like                                    
   7::125  1.2e-06 21.2% 0048656 00486561 1/1   like                                    
   7::127  1.4e-06 21.2% 0049456 00494561 1/1   like                                    
   6::143  1.5e-06 21.2% 0045682 00456821 1/1   like                                    
   6::130  1.6e-06 24.4% 0048685 00486851 1/1   like                                    
   7::129  2.2e-06 24.2% 0048129 00481291 1/1   like                                    
   6::135  5.1e-06 20.5% 0051318 00513181 1/1   like                                    
   8::135  6.8e-06 23.3% 0048997 00489971 1/1   like                                    
   7::125  7.5e-06 23.9% 0049761 00497611 1/1   like                                    
   6::127  1.3e-05 21.7% 0051898 00518981 1/1   like                                    
   4::130  1.6e-05 23.2% 0047555 00475551 1/1   like                                    
   2::129  2.8e-05 23.0% 0048705 00487051 1/1   like                                    
   1::696


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLSSKNIVRLLIVDASFEDAEMVTNLLRKMGFAARASRVEKEEEFREAIEGQSWDIIVCAAMLPQFSVAR
00519461   1/1  ----------------------------------------------------------------------
00503431   1/1  ----------------------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00399251   1/1  -plslsglrvLvVdDdplirellrrlLeklgylevvltaadgeealellrelgalaglelglrpdlvllD
00503421   1/1  -------llllllsllllsglriLvVdDdplirellarlLeklgyev....aadgeealellrelppdlv
00477531   1/1  -----kglriLiVdDdplirellrrlLeklgllyvvltaadgeealellrellalgslerpdlvllDlnm
00515731   1/1  ------glriliVdDdpllrellallLeklgy..vvltaadgeealellrelrpdlvllDimmPgmdGle
00480661   1/1  ---lrsklrilivdddpalrellrrlLeaegyq..vlvaesgeealelleehrpdlvlldlmlPgmdgle
00515741   1/1  -------lriLvvdDdpllrellrllLeslgy..vvleaadgeealellrelrpdlvllDlmmPgmdGle
00489751   1/1  -------lriliVdDdplirellrllLerlgye..vltaadgeealellrelrpdlvllDirmPgmdGle
00435251   1/1  -------msglrvLvVDDdplirellrrlLerlgy..evvgtaadgeeAlelleelppdlvllDirmPgm
00518601   1/1  -------ealsslsglrilvVdDdplvrellrrlLerlgyevv..taadgeealellrelppdlvllDlr
00462991   1/1  --------lllelsglrvLvVdDnplnrellkalLeklgy..evltasngeealell.elppdlvllDiq
00464281   1/1  ------klrilivdDdpllrellrllLeslgllyvvltaadgeealelleelrpdlvllDimmPgmdGle
00477991   1/1  ------glrilvvdDdpllrellallLeklgy..vvltaadgeealellrelppdlvllDimmPgmdGle
00472961   1/1  -------lsglriLiVdDdplirellrrlLeklgllyevleaadgeealellrellelgdllrpdlvllD
00484651   1/1  -------lriLiVdDdplirellrllLeklgye..vltaadgeealelleelrpdlvllDlmmPgmdGle
00482311   1/1  -----sglrilvvdDdpllrellallLeklgy..vvltaadgeealellrelrpdlvllDimmPgmdGle
00503411   1/1  ------glriLvVdDdpllrellrllLeklgy..evltaadgeealellrelrpdlvllDimmPgmdGle
00457001   1/1  ----lsklriliVdDdplirellrrlLeslgdlyvvltaadgeealellrelrpdlvllDlmmPgmdGle
00513861   1/1  ------glrilvvdDdpllrellallLeslgy..vvltaadgeealellrelrpdlvllDlmmPgmdGle
00484631   1/1  -------lrilivdDdpllrellallLeklgy..vvltaadgeealellrelrpdlvllDimmPgmdGle
00462941   1/1  ----lsklriliVdDdplvrellallLeslgy..vvltaadgeealellrelrpdlvllDlrmPgmdGle
00478671   1/1  ----lsglrilvvdDdpllrellallLeslgy..vvltaadgeealellrelrpdlvllDlrmPgmdGle
00509641   1/1  -----sglrilvVdDdpllrellrllLeslgy..evltaadgeealelleelrpdlvllDimmPgmdGle
00458521   1/1  ------glriLvVdDdpllrellallLeslgy..vvltaadgeealellrelrpdlvllDlmmPgmdGle
00486561   1/1  ------glrilvvdDdpllrellkllLeklgyev.vlvaadgeealellrellesglrpdlvllDilmPg
00494561   1/1  ------klrilivdDdpllrellallLeslgy..vvltaadgeealellrelrpdlvllDllmPgmdGle
00456821   1/1  -----kklriliVdDdplirellrrlLeslgdlyvvleaadgeealellrelrpdlvllDlmmPgmdGle
00486851   1/1  -----sglrilivdDdpllrellallLeslgy..vvltaadgeealelle...pdlvllDilmPgmdGle
00481291   1/1  ------glriLvvdDdpllrellallLeklgy..vvltaadgeealellrelrpdlvllDimmPgmdGle
00513181   1/1  -----sglrilvVdDdplirellrllLeslgye..vltaadgeealellrelrpdlvllDirmPgmdGle
00489971   1/1  -------ltllllknlrglrilvvdddplvrellrrlLerlgyevva..aadgeeale....lrpdlvll
00497611   1/1  ------glrilivdDdpllrellallLeklgyevvg.eaadgeealellrelrpdlvllDllmPgmdGle
00518981   1/1  -----sglrilvvdDdpllrellallLeslgyevv..taadgeealellrelerpdllvllD.llPgmdG
00475551   1/1  ---llsglriLvVdDdpllrellrllLeklgye.vvleaadgeealellrelrpdlvllDlmmPgmdGle
00487051   1/1  -llllsglriLvVdDdplirellallLeslgye.vvltaadgeealellrelppdlvllDlmmPgmdGle


                         -         -         *         -         -         -         -:140
query           AAQILLQSEKDISLIIVVDEKTDSDDIDEMYVAGVRDVVLKSRPLRLQSVIKRELQDLENRRARRHSEMV
00519461   1/1  ----------------------------------------------------------------------
00503431   1/1  ----------------------------------------------------------------------
00372191   1/1  ------------------------------------------------------------Iterkraeea
00501091   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/1  -----------------------------------------------------------Diterkraeee
00482481   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00399251   1/1  inmPgmdGlellrrlralpllpdipvivlTa.ladeedrvraleaGaddyllKPfdleeLlaairall--
00503421   1/1  llDlmmPgmdGlellrrlrelpalpdipvillTa.lddeedrvraleaGaddyltKPfdpeeLlariral
00477531   1/1  PgmdGlellrrlrelpllpdip.vivlTalddeedavraleagaddyllKPfdleeLlaairallr----
00515731   1/1  llrrlre..lpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrrl-----------
00480661   1/1  llrqLreeglllPvill....tarddrvaaldagaddyltkPfllpvdqleeLlaridaalrrfllla--
00515741   1/1  llrrlre..lpdipvivlTalddeedavraleagaddyllKPfdleeLlaalrallrrl-----------
00489751   1/1  llrrlrelg.pdlpvillTayddeedavraleagaddyllKPfdleeLlaairallrrlrllrellllll
00435251   1/1  dGlellrrlre.lpdipvillTa.yadeedavraleaGaddyltKPfdleeLlaalrralerrrllrelr
00518601   1/1  mpgmdGlellrrlrellpdip.villTayadeedavraleagaddyllK..PfdleeLlaalrallr---
00462991   1/1  mPgmdGlellrrirelellpllpdipiialtayadeedreraleagaddyltKPvsleeLla--------
00464281   1/1  llrrlrelplpdipvivlTaladeedavraleagaddyllKPfdleeLlaalrallr-------------
00477991   1/1  llrrlrelg.pdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrrlr----------
00472961   1/1  lnmPgmdGlellrrlrelpalpdip.vivlTalddeedavraleagaddyltKPfdleeLlaairallr-
00484651   1/1  llrrlrelg.pdipvillTayadeedavealeagaddyllK..PfdleeLlaairallrrlrllrellll
00482311   1/1  llrrlrelg.pdipvillTalddeedavraleagaddyllKPfdleeLlaalrallrr------------
00503411   1/1  llrrlrelpllpdipvillTa.lddeedavraleagaddyltK..PfdleeLlarirallrrlrllsell
00457001   1/1  llrrlre..lpdipvivlTalddelledavraleagaddyllKPfdleeLlaairallrrlrllsellal
00513861   1/1  llrrlrelg.pdipvivlTaladeedavraleagaddyllKPfdleeLlaalrallrrl-----------
00484631   1/1  llrrlre..lpdipvillTalddeedavraleagaddyllKPfdleeLlaalrallrrl-----------
00462941   1/1  llrrlrell.pdipvillTayddeedavealeagaddyllKPfdleeLlaairallrrl-----------
00478671   1/1  llrrlrell.pdlpvillTaladeedavraleagaddyllKPfdleeLlaairallrrl-----------
00509641   1/1  llrrlre..lpdipvillTaladeedavraleagaddyllKPfdleeLlaalrallrrr-----------
00458521   1/1  llrrlrellllpdip.villTaladeedavraleagaddyllKPfdleeLlaairal-------------
00486561   1/1  mdGlellrrlrelllpdipvillTaladeedavraleagaddyllKPfdleeLla---------------
00494561   1/1  llrrlrell.pdipvillTayadledavraleagaddyllKPfdleeLlaalrallr-------------
00456821   1/1  llrrlrell.pdipvivlTayddeedavraleagaddyllKpfdleeLlaairallrrlrllsellaell
00486851   1/1  llrrlrell.pdipvillTalddeedavealeagaddyllKPfdleeLlaairallrrlr----------
00481291   1/1  llrrlrelpalpdipvillTa.ladeedavraleagaddyllKPfdleeLlaalrallr-----------
00513181   1/1  llrrlrell.pdipvillTayddeedavraleagaddyllKPfdleeLlaairallrrlrllsen-----
00489971   1/1  dlrmpdmdglellallre..lpdlpvivltayedpelleaaleagaldylvkPldpeeLlaalel-----
00497611   1/1  llrrlrell.pdlpvivlTaladeedavealeagaddyllKPfdleeLlaalral---------------
00518981   1/1  lellrrlrellpdlpvillTaldde...avraleag.ddyllKPfdleeLlaalrrr-------------
00475551   1/1  llrrlrelpllpdipvillTa.ladeedavraleagaddyllKPfdleeLlaalrallrr----------
00487051   1/1  llrrlrelpllpdipvillTa.ladeedavraleagaddyllKPfdleeLlaalrallr-----------


                         +         -         -         -         -         *         -:210
query           LGESERQVRALLESSRDAVGYVHEGMHIYANRAYLELFGYHELDEIEGMPLLDMIAPEEHNRFKAFLKEY
00519461   1/1  ----------------------------------------------------------------------
00503431   1/1  ----------------------------------------------------------------------
00372191   1/1  lreseerlrallesapdgiivldldgrilyvNpaaerllGy.speellGkslldllppedrervlealrr
00501091   1/1  ----a.rlralleaapdgiivldldgrilyvNpaaerllGy.speellGkplldllhpedrervlealer
00405361   1/1  --------rllleaapdgilvldldtgrilyvNdaaerllGys.peellGkslldllhpedreavleale
00463771   1/1  ----------------DgiivldldgrilyvNpaaerllGy.saeellgknlldlippedrerllaalrr
00484591   1/1  lreseerlralldslpdgiivlDadgrilyvNpaaeellGy.speeliGknlfellhpedlreavleall
00482481   1/1  ---seerlralldaapdgiivlDadGrilyvNraaerllGy.speeviGrnlfsellppedrpafeaall
00487151   1/1  ----------lleaapdgifvldldgrilyvnpaflellGy.speellgkslldlihpedrervlealee
00460451   1/1  ------------eaapdgivitdldgrilyvNpaferllGy.sreellgkslllldllhpedrervlaal
00486441   1/1  ---------allenapdgiivlDadgrilyvNpaaeellGy.speeviGknlfdllippedreevlealr
00412791   1/1  ----------lleaapdgiwitdldgrilyvNpaferllGy.speellgknlrelvhpedrervlealrr
00469031   1/1  -------------napdgiiitdldgrilyvNdaflellGy.sreellgknlrdlvhpedreavlaalwe
00485791   1/1  --------------lddfifvldadGriiyvneaalrallGy.speeliGksiydfvhpedreesalrea
00399251   1/1  ----------------------------------------------------------------------
00503421   1/1  lrrrrllre-------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00489751   1/1  llellldll-------------------------------------------------------------
00435251   1/1  lllellelllelrlllldalllllig--------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00484651   1/1  lellelllg-------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00503411   1/1  llleelel--------------------------------------------------------------
00457001   1/1  lll-------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00456821   1/1  lel-------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           GASEGKSAHFTLRAHKADGHTFTAAWEFTPASIEGEFCTQIVIRDKTYDLAAEERIKQVQQRDILTGFFS
00519461   1/1  ----------------------------------------------------------------------
00503431   1/1  ----------------------------------------------------------------LTglpn
00372191   1/1  alaggeplllgvslelrlrrkdGelrwvevsaspirdeggrgvvgvv-----------------------
00501091   1/1  alaggepvllgvegelrlrrkdGevrwvevsaspirdedgvgvvg-------------------------
00405361   1/1  ralaggevvtlllllelrlrrkdGsvrwvevsaspirdeggrv.vgv-----------------------
00463771   1/1  alaggeplllgvelelrlrrkdGslfwvelsisplrdeggegvvgvlrDiTerkraeee-----------
00484591   1/1  ealatg.epvrgelrlrrkdGsrrwv..svspirdedGevvgv---------------------------
00482481   1/1  ralatgep...lelrlrrkdGsrrwvlvtvsplrdedGevvgv---------------------------
00487151   1/1  alagg.epfsgeyrlrrkdGsyrwvevsaspirdeldgkvvgvvgva-----------------------
00460451   1/1  rralagg.epfsgelrlrrkdGslfwvllsvspirdedGevvgvvgv-----------------------
00486441   1/1  ealagge...svelrlrrkdGslrwvevsaspirdedGevvgv---------------------------
00412791   1/1  alagg.epfsgelrlrrkdGslrwvllsispirdedGevvgvvgiar-----------------------
00469031   1/1  alrgg.epwsgelrlrrkdGelrwvelsispirdedGevvgfvgv-------------------------
00485791   1/1  leevla.kgevrsfeyrflrkdGsyvwletsatpildpdtgkleg-------------------------
00399251   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           RPHYLELMEKWVIAARAGDRESSLLYIAIDQFNRVRARVGIGASDLVVVDVARILQQYCDEKVILARFGD
00519461   1/1  ----------------------------------------------------------------------
00503431   1/1  rraflerlerllararrsglplalllldldnfklindtyGhaagDevLkevaerlksllregdlvaRlgg
00372191   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           EVFTLLLPHGSDEQEDALAEQLRQAVDRHLVEMDERSINVTCSIGICRIGESAPGGQQILERAHKACLKA
00519461   1/1  ----------------------------------------------------------------------
00503431   1/1  deFavllpdtdleealalaerlrealeelllpflldglellvtvsiGvalypddgedleellkrAdlaly
00372191   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           QEAGGNRIERYRPVIEDLTDQEKIKQWEVQLREAMNNKDGFCLFYQPIVSLHGETEEIFEVLLRMTDDAG
00519461   1/1  ---------------------------eddLrralen.gelvlyyQPivdlrtgrvvgyEallRwrhpeg
00503431   1/1  raKragrnrvvly---------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           GYILPEKFLEPAAQLKLMGEIDRWVIAKAMSVLHSRHQVGQLIRFFVKLSDPSIHDKNLLPWLKKHLQES
00519461   1/1  glispdefiplaeetgliveldrwvleqalrqlaaw...gldlrlsvNlsarqlldpdfvegllllelle
00503431   1/1  ----------------------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------


                         -         -         -         *         -         -         -:630
query           GLDARSLIFEISESSALNYLKRVQQLVEGLRVLGCQFALEHVGTGLDTSNCLKHINVDYLKIDGAFIENL
00519461   1/1  elglppsrlvlEitEsallddlelllellerlrelGvrialDdfgtgysslsylkrlpvdilKiDrsfvr
00503431   1/1  ----------------------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------


                         -         +         -         -         -         -         *:700
query           LQDEQNQEAVKIIIEMAKEAGKPTIAEFVSDANTLALLWQFGLDYAQGRYIQEPNQFLSYEFSGGI----
00519461   1/1  diltdpldlaivraiialakslglkvvaEgVEteeqlellrelgcdlaQGylfs----------------
00503431   1/1  ----------------------------------------------------------------------
00372191   1/1  ----------------------------------------------------------------------
00501091   1/1  ----------------------------------------------------------------------
00405361   1/1  ----------------------------------------------------------------------
00463771   1/1  ----------------------------------------------------------------------
00484591   1/1  ----------------------------------------------------------------------
00482481   1/1  ----------------------------------------------------------------------
00487151   1/1  ----------------------------------------------------------------------
00460451   1/1  ----------------------------------------------------------------------
00486441   1/1  ----------------------------------------------------------------------
00412791   1/1  ----------------------------------------------------------------------
00469031   1/1  ----------------------------------------------------------------------
00485791   1/1  ----------------------------------------------------------------------
00399251   1/1  ----------------------------------------------------------------------
00503421   1/1  ----------------------------------------------------------------------
00477531   1/1  ----------------------------------------------------------------------
00515731   1/1  ----------------------------------------------------------------------
00480661   1/1  ----------------------------------------------------------------------
00515741   1/1  ----------------------------------------------------------------------
00489751   1/1  ----------------------------------------------------------------------
00435251   1/1  ----------------------------------------------------------------------
00518601   1/1  ----------------------------------------------------------------------
00462991   1/1  ----------------------------------------------------------------------
00464281   1/1  ----------------------------------------------------------------------
00477991   1/1  ----------------------------------------------------------------------
00472961   1/1  ----------------------------------------------------------------------
00484651   1/1  ----------------------------------------------------------------------
00482311   1/1  ----------------------------------------------------------------------
00503411   1/1  ----------------------------------------------------------------------
00457001   1/1  ----------------------------------------------------------------------
00513861   1/1  ----------------------------------------------------------------------
00484631   1/1  ----------------------------------------------------------------------
00462941   1/1  ----------------------------------------------------------------------
00478671   1/1  ----------------------------------------------------------------------
00509641   1/1  ----------------------------------------------------------------------
00458521   1/1  ----------------------------------------------------------------------
00486561   1/1  ----------------------------------------------------------------------
00494561   1/1  ----------------------------------------------------------------------
00456821   1/1  ----------------------------------------------------------------------
00486851   1/1  ----------------------------------------------------------------------
00481291   1/1  ----------------------------------------------------------------------
00513181   1/1  ----------------------------------------------------------------------
00489971   1/1  ----------------------------------------------------------------------
00497611   1/1  ----------------------------------------------------------------------
00518981   1/1  ----------------------------------------------------------------------
00475551   1/1  ----------------------------------------------------------------------
00487051   1/1  ----------------------------------------------------------------------