[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA56915.1


[Show Plain Result]

## Summary of Sequence Search
   1::406
 120::360  3.6e-54 38.3% 0044734 00447341 1/1   A polymerase C-terminal region-like     
 120::407  1.1e-53 33.9% 0040956 00409561 1/1   A polymerase C-terminal region-like     
 120::340  2.2e-45 38.3% 0042030 00420301 1/1   A polymerase C-terminal region-like     
   1::119    1e-29 49.1% 0040957 00409571 1/1   otidyltransferase                       
   1::119  2.9e-29 48.2% 0042031 00420311 1/1   otidyltransferase                       
   1::119  1.6e-27 50.0% 0044735 00447351 1/1   otidyltransferase                       
   1::406


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEVYLVGGAVRDKLLGRPVKERDYVVVGTTPANLLAQGYRPVGKDFPVFLHPQTQEEYALARTERKTGPG
00447341   1/1  ----------------------------------------------------------------------
00409561   1/1  ----------------------------------------------------------------------
00420301   1/1  ----------------------------------------------------------------------
00409571   1/1  leaylvGGaVRDlllglppkDlDiav.datpeevlellaklllvgkefgtvtvllggllievatlrtely
00420311   1/1  leaylvGGaVRDlllglppkDiDiav.datpeevakllakllikllvlvgkrfgtatvllggllievatl
00447351   1/1  leaylvGGavRDlllglpvkDlDivv.datpeevlellakalgllvlvglefgtvtvvlggllievatlR


                         -         -         *         -         -         -         -:140
query           YKGFEVDAAPDVTLEEDLQRRDLTINAIAEAADGSLLDPFGGQQDLARGILRHVSPAFAEDPVRILRAAR
00447341   1/1  -------------------------------------------------ilRtvgdprFlEDPlRiLRav
00409561   1/1  -------------------------------------------------ilRtvgdPeerFrEDPLRiLR
00420301   1/1  -------------------------------------------------ilrtvgdpeerFrEDpLRiLR
00409571   1/1  tsdgrlplvvlflg..tleeDllrRDfTiNAlaldldgeliDpfgGled---------------------
00420311   1/1  rtevytsggrlpvvflg....tleeDllrRDfTiNAlaldldgeliDpf---------------------
00447351   1/1  tevytsggrlpvvflg....tleeDllrRDftiNAlaldlneeldgeli---------------------


                         +         -         -         -         -         *         -:210
query           FAARFNFKVAPETLALMEAMVTAGEADHLVPERVWRELERALGESYPRRFFEILRACGALARIFPEIECL
00447341   1/1  RFaarlgftiepetleaireavlagllakisaeRirvEllklLlspnplaalellrelgllevlfpelal
00409561   1/1  avRFaarlgftidpetlaairela..gllakisaeRirvEllklLlgpnplralqllrelgllevlfpel
00420301   1/1  avRFaarlgftgfsidpetlaaikela..gllaklsaeRiwvEllKlLlgpnpsaalkllrelgllkvlf
00409571   1/1  ----------------------------------------------------------------------
00420311   1/1  ----------------------------------------------------------------------
00447351   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           FGVPQPRRYHPEIDTGIHTLKVLEIAAHLSSDTQVRFAALTHDLGKGQTPSHEWPHHYGHGERGVALVLT
00447341   1/1  llgvlqllehllkll.ntltllald...kpvsplllrlaallhdlgkeltpa..................
00409561   1/1  aallg.......lpeldrlihlllv.........dlllrlaallhdlgkpltpa................
00420301   1/1  peldalldlln...............tllrvaadlsldpllrlaallhdlgk..................
00409571   1/1  ----------------------------------------------------------------------
00420311   1/1  ----------------------------------------------------------------------
00447351   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           LCQRLRVPKAYQALAVQVARYHNLVHQAQELRPGTILKLLNRVDAFRRPSRFEQFLLACEADARGRSGLE
00447341   1/1  .llkrlklpkkeidlvlllvelhlrllk....rlgkrlslsllydllrragrllllllllladirgvlgl
00409561   1/1  ...llkrlklsnelrklvlllvelhllll....lslsallrllrdlglllal.....lllllladellal
00420301   1/1  ...leallkrlklsnkeiklvlllvalhlvllellellalrrllyrlgleilllllrlll----------
00409571   1/1  ----------------------------------------------------------------------
00420311   1/1  ----------------------------------------------------------------------
00447351   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           NRPYPQANQLRLAFRAAAAVTARPLVAAGLRGEAIAEQLQQQRIKAIKQAVHTERG--------------
00447341   1/1  wltrllnvkd------------------------------------------------------------
00409561   1/1  psrllelirellalllrllkpkllingkdllkllglkpgprlgealdelllavlege-------------
00420301   1/1  ----------------------------------------------------------------------
00409571   1/1  ----------------------------------------------------------------------
00420311   1/1  ----------------------------------------------------------------------
00447351   1/1  ----------------------------------------------------------------------