[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA56917.1


[Show Plain Result]

## Summary of Sequence Search
   1::454
   3::454 9.7e-142 39.8% 0035565 00355651 1/1   like                                    
   1::454 2.5e-141 39.4% 0044574 00445741 1/1   like                                    
   3::454 3.9e-140 39.8% 0036174 00361741 1/1   like                                    
   3::454 4.6e-138 40.0% 0041750 00417501 1/1   like                                    
   3::454 1.5e-135 39.8% 0035766 00357661 1/1   like                                    
   3::454   4e-135 39.8% 0034877 00348771 1/1   like                                    
   3::454 8.6e-135 40.0% 0035037 00350371 1/1   like                                    
   3::455 4.9e-133 39.8% 0050666 00506661 1/1   like                                    
   3::454 1.6e-132 39.7% 0040316 00403161 1/1   like                                    
   3::456   2e-128 39.5% 0037193 00371931 1/1   like                                    
   3::454 4.2e-128 40.8% 0037277 00372771 1/1   like                                    
  24::454 3.4e-124 41.5% 0035003 00350031 1/1   like                                    
  23::454 2.5e-111 42.7% 0041670 00416701 1/1   like                                    
   2::415 2.2e-102 40.7% 0047758 00477581 1/1   like                                    
  21::454 2.6e-101 37.7% 0044883 00448831 1/1   like                                    
   1::454


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MAFESVNPATGQSLKTFDAWDQNAIDGVLQQVQEASPLWAARDLSERCRLLRAAAQQLRERKEDLARLIT
00355651   1/1  --llllllllllllllllltlkllingewvagasgetldvinPatgevlatvplasaedvdaaveaaraa
00445741   1/1  lellellnelllllllgslllllllllllllllllltlklliggewvagsgetldvinPatgevlatvpl
00361741   1/1  --lllllllllllltlkllingewvasasgetldvinPatgevlatvplasaedvdaaveaaraafksge
00417501   1/1  --lelllllllllltlklfigGewvasasgetldvinPatgevlatvplataedvdaaveaaraafksgl
00357661   1/1  --lelllllllllltlklligGewvasasgetldvinPatgevlatvplasaedvdaavaaaraafksgl
00348771   1/1  --lllllllllllllllllltlklfiggewvaslssgetlevinPatgevlatvplasaedvdaaveaar
00350371   1/1  --lsllllllllltlklligGewvasasgetldvinPatgevlatvplasaedvdaavaaaraafksgea
00506661   1/1  --ltlkllinGewvagsgetlevinPatgevlaevplasaedvdaavaaaraafkawralsleeRaaill
00403161   1/1  --lellllllllllllltlklfigGewvasgetidvinPatgevlatvplataedvdaaveaaraafeka
00371931   1/1  --lltlklliggewvasgetlevinPatgevlatvplasaedvdaaveaaraafkawaalsaaeRaaill
00372771   1/1  --sgetlevinPatgevlagtvplataedvdaavaaaraafkawaalslaeRaaillkladlleeradel
00350031   1/1  -----------------------dvdaaveaaraafkawaalsleeRaaillaladlleenadelaallt
00416701   1/1  ----------------------edvdaaveaaraafrawatlsleeRaaillkladlleenaeelaallt
00477581   1/1  -llllllsllagsgetlevlnPatgev............daavaaaraafeawralglaeraelllkl.d
00448831   1/1  --------------------saedvdaaveaAraafrawatlsleeRaaiLlaladlleenadelaeala


                         -         -         *         -         -         -         -:140
query           LEMGKLLGEARAEIEKCAWVCEYYEEHAPRFLADEVIESDARRSYVALQPLGTVLAIMPWNFPFWQVFRF
00355651   1/1  fdsgkawaalsaaeRaaillkladlleeradelaalltletgkplaeallgevlraadflryyaglarrl
00445741   1/1  ataedvdaavaaaraafkawaalsaaeRaaillkladlleeradelaalltletgkplaealgevaraad
00361741   1/1  awaalsaaeRaaillkladlleeradelaalltletgkplaeallgevaraadflryyagladrllgevi
00417501   1/1  awaalsaaeRaaillkladlleeradelaalltletgkplaeallgevlraadflryyaglarrllgevi
00357661   1/1  awaalsaaeRaaillkladlleeradelaalltletgkplaeallgevaraadflryyaglarrllgevi
00348771   1/1  aafkawaalsaaeRaaillkladlleeradelaalltletgkplaealgevaraadflryyaglarkllg
00350371   1/1  waalsaaeRaaillkladlleeradelaalltletgkplaeallgevlraadflryyaglarrllgevip
00506661   1/1  kladlleeraeelaalltletgkplaeallgevaraadflryyaglarrllgetilsdgpgllalvvreP
00403161   1/1  waalsaaeRaaillkladlleeradelaalltletgkplaealgevllaadflryaaglarrllgltipv
00371931   1/1  kladlleenadelaalltletgkplaealgevlraidflryyaglarkllgpvipvvglllllpgllllv
00372771   1/1  aalltletgkplaealgevllaidflryaaglarkllgltipvglllllllllpgllayvvrePlGvvgv
00350031   1/1  letgkplaeallgevllaadflryyaglarkllglvipvgllllpglllyvvrePlGvvavitPwnfPll
00416701   1/1  letgkplaealgedlllrllltlervalaadllryvagladrllglllllvldpglllyvvrePlGvvgv
00477581   1/1  lleenaeelaalltleagkplaealgeavalaadflryfae.aqkllgpviellpgvllyvrrePlgvvg
00448831   1/1  lelgkplaealldalldrLllteggevllaadvlryaagladplggvvlvlelpnglllyvvrePlGvva


                         +         -         -         -         -         *         -:210
query           CAPALVAGNTAVLKHAANVPQCGLAIEQTLLEAGFPPGVFRTLLVSSSQTAKVIADPRVQGVTLTGSEAA
00355651   1/1  lgevipsdpgllayvvrePlGvvavitPwnfPlllalwklapALaaGntvvlKpseltpltalllaelll
00445741   1/1  flryyaglarrllgevivstllpgllalvvrePlGvvavitPwNfPlllalwklapALaaGntvvlKpse
00361741   1/1  psdpglllyvvrePlGvvavitPwnfPlalalwklapaLaaGntvvlKpseltplsalllaellleaglP
00417501   1/1  psdpgllayvvrePlGvvavitPwnfPlllalwklapaLaaGntvvlKpseltpltalllaellleaglP
00357661   1/1  psdpgllayvvrePlGvvavitPwnfPlalalwklapaLaaGntvvlKpseltpltalllaellleaGlP
00348771   1/1  evipsdpgllayvvrePlGvvavitPwnfPlalalwklapALaaGntvvlKpseltpltalllaellrea
00350371   1/1  sdpgllalvvrePlGvvavitPwnfPlalalwklapaLaaGntvvlKpseltplsalllaellleaglPa
00506661   1/1  lGvvaaitPwNfPlalalwklapaLaaGntvvlKpseltpltalllaell.eaglPegvvnvvtgdgaev
00403161   1/1  gvilllpgllayvvrePlGvvavitPwnfPlllalwklapaLaaGntvvlKpseltplsalllaellrea
00371931   1/1  vrePlGvvavitPwnfPlllalwklapaLaaGntvvlKpseltplsalllaellleaglPegvvnvvtgp
00372771   1/1  itPwNfPlalalagwklapALaaGntvvlKpseltplsalllaelirealeeaglPegvvnvvtgsgrev
00350031   1/1  lalwklapaLaaGntvvlKpseltplsalllaell.eaglPegvvnvvtgdgevvgall.hprvdlvsft
00416701   1/1  itPwnfPl.la.rkaapaLaaGNavvlkpseltplsalalaelirealeeaglPegvvnvvtgdgraevg
00477581   1/1  vivPwNfPlalstvlmklapAlaaGvpntvvlkPseltpltal....llaeaglp.gvlnv..ggaeaga
00448831   1/1  vitPwnfPl.la.wkaalaLaaGNavvlkpseeaplsalalaellaealaeevgeaglPegvvnlvtggr


                         -         -         -         +         -         -         -:280
query           GRKVAECAGRHLKKTVLELGGADPFIVLADADLEQAVPVAVQSRFINGGQSCIAAKRFIVMEEIADEFIA
00355651   1/1  eaGlPagvvnvvtgpgaevgeaLvahpdvdlvsftGstavgrliaeaaaksnlkpvtlelgGknpviVld
00445741   1/1  ltpltalllaellreaGlPagvvnvvtgpgaevgeaLvahprvdlvsftGstavgkavaeaaakrldlls
00361741   1/1  agvvnvvtgpgaevgdaLlahpdvdlvsftGstavgrliaeaaaysnlkpvtlelgGknpvivlddadld
00417501   1/1  agvvnvvtgpgaevgdaLlahprvdlvsftGstavgrlvaeaaaksnlkpvilelgGknpvivlddadld
00357661   1/1  agvvnvvtgpgaevgeaLvahpdvdlvsftGstavgrliaeaaaksnlkpvtlelgGknpviVlddadld
00348771   1/1  GlPagvvnvvtggaevgeaLvahpdvdlvsftGstavgrlvakaaasnlkpvtlelgGknpvivlddadl
00350371   1/1  gvvnvvtgpgaevgeaLlahpdvdlvsftGstavgrlvaeaaaksnlkpvilelgGknpvivlddadldl
00506661   1/1  geallahpdvdlvsftGstavgravakaaaknlkpvtlelgGknpvivlddadldlaveaivagaflnaG
00403161   1/1  glPagvvnvvtgdgevgeaLvahpdvdlvsftGstavgrlvaaaa..nlkpvilelgGknpvivlddadl
00371931   1/1  gaevgeaLlahprvdlvsftGstavgrlvaaaa..nlkpvilelgGknpvivlddadldlaveaivlskf
00372771   1/1  geaLvahprvdlvsftGstavgrlvaeaaaknlkpvpvtlelgGknpvivlddadldlaelvkaivagkf
00350031   1/1  GstavgrlvaeaaasnlkpvilelgGknpvivdddadldlaveaivlgkflnaGqvCtapsrllVhesia
00416701   1/1  eaLvahplvdlvsftGstavgkavae....nlkpvvlelgaGknpvivdedadldlaveaivlgkflnaG
00477581   1/1  aLayGteshprvdkisftGstav.ravaraaaknlkpvtlEllgGkspviVladetadldl.....vaga
00448831   1/1  evgdaLlehplvdliiftGstavgravaeaa...lkpvilelgGknpvivdedadldlavkiivnakffn


                         -         *         -         -         -         -         +:350
query           RFQADLEALQPGDPLDEQTTLAPLARLDLRAGLHQQVTASIQQGAVAVAGCQPLPGTGTYYAPSILDRVQ
00355651   1/1  dadldlaveaivasaflnaGqvCtaasrllvhesiydefvealvealaklkvgdpldpdtdlgplisaaa
00445741   1/1  nlkpvtlelgGknpvivlddadldlaveaivagaflnaGqvCtapsrllVhesiydefvealvealaklk
00361741   1/1  laveaivaskflnaGqvCtaasrllVhesiydeflealvealaklkvgdpldpdtdlgpliseaaldrvl
00417501   1/1  laveaivaskflnaGqvCtaasrllVhesiydeflealvealaklkvgdpldpgtdlgplisaaqldrvl
00357661   1/1  laveaivaskflnaGqvCtaasrllVhesiydeflealvealaklkvgdpldpdtdlgplisaaaldrvl
00348771   1/1  dlaveaivaskflnaGqvCtaasrllVhesiydeflealvealaklkvgdpldpdtdlgpliseaqldrv
00350371   1/1  aveaivaskflnaGqvCtaasrllVhesiydeflealvealaklkvgdpldpgtdlgpliseaqldrvlg
00506661   1/1  qvCtapsrllVhesiydefvealvealaklkvgdpldpgtdlgpliseaaadrvlgliedavaegakvll
00403161   1/1  dlaveaivagkflnaGqvCtaasrllVhesiadeflealvealaklkvgdpldpgtdlgpliseaqldrv
00371931   1/1  lnaGqvCtalsrllVhesiadeflealvealaklkvgdpld.dtdlgplisaaaldrvlgliedavaega
00372771   1/1  lnaGQvCtapsrllVhesiaydeflealv......kvgdpldpstdlgpliseaqldrv...iedavaeg
00350031   1/1  deflealvealakl.vgdpldestdlgpliseaalervlglie.....gakvlaggerleg.gyfvaptv
00416701   1/1  q.CtalerllVhesiadefleal..................................iedaveegaklla
00477581   1/1  flnaGqvCtaasrllVtdhesiadefvealvealkalkvgdpldestdlgplisadqlervleliddaaa
00448831   1/1  aGq.CnalerllVhesiadeflealve...........ledtdvgplideaalervlglielaveeg...


                         -         -         -         -         *         -         -:420
query           PGMPAFDEELFGPVAAIIRVANEAEAVAMANASRYGLGGSVWSQNTSRAERLALELRCGAAFVNGLVKSD
00355651   1/1  ldrvlgliedavaegaklllggerldeggyfvePtvltdvtpdmrilqeEifgPvlpvvrvddldeaiel
00445741   1/1  vgdp.dpdtdlgplisaaaldrvlgliedavaegaklllggerleg.gyfvePtvltdvtpdmpilqeEi
00361741   1/1  eliedavaegaklllggerldeggyfvePtvltdvtpdmrilqeEifgPvlavvrvddldeaialandte
00417501   1/1  eliedavaegaklllggerldeggyfvePtvltdvtpdmrilqeEifgPvlpvvrvddldeaielandte
00357661   1/1  gliedavaegaklllggerldeggyfvePtvltdvtpdmrilqeEifgPvlpvvrvddldeaielandte
00348771   1/1  leliedavaegaklllggerlvllgelleggyfvePtvltdvtpdmrilqeEifgPvlavvrvddldeai
00350371   1/1  liedavaegaklllggerldeggyfvePtvltdvtpdmrilqeEifgPvlavvrvddldeaialandtey
00506661   1/1  ggerldleggyfvePtvltdvtpdmpilqeEifgPvlpvvrvddldeaielandteyglaasvftrdlar
00403161   1/1  lgliedavaegaklllggerle..gyfvePtvlevdtdvtpdmpilqeEifgPvlpvvrvddldeaiela
00371931   1/1  klllgg...drggyfvePtvltdvtpdmpilqeEifgPvlavvrvddldeaielandtgygltaaiftrd
00372771   1/1  akllagg...d.ggyfveptvltdvtlelpdmrilqeEifgPvlavvrvddldeaialandteygLtaav
00350031   1/1  ltdvtpdmpilqeEifgPvlavvrvddldeaielandtgygltaaiftrdleralrfarrleagrvlvNa
00416701   1/1  gg.....kglfvaptvltdvdpdm...qeEifgPvlavirvddldeaielandtgygltaaiftedlera
00477581   1/1  egaelltggprlllggyfvaPtvllg.tpdmeilgeEifGPnhvlPtsglarfssvlsvlrfddl-----
00448831   1/1  ..........glfvaptvltavded...mqeEifgpvlavvvvddldeAielindtgygltaaifTedle


                         -         -         +         -         -         -         -:490
query           PRLPFGGIKCSGYGRELSWHGMREFTNQKTLWIK------------------------------------
00355651   1/1  andteygltaavftrdlaralrvarrleagrvlv------------------------------------
00445741   1/1  fgPvlpvvrvddldeaielandteyglaaavftr------------------------------------
00361741   1/1  ygltaaiftrdlerarrvarrleagrvyvNdptt------------------------------------
00417501   1/1  ygltaaiftrdlaralrvarrleagrvyvNdstt------------------------------------
00357661   1/1  ygltaavftrdlaralrvarrleagrvlvNdptt------------------------------------
00348771   1/1  elandteyglaaavftrdlaralrvarrleaGrv------------------------------------
00350371   1/1  glaaaiftrdlaralrvarrleagrvyvNdpttg------------------------------------
00506661   1/1  alrvarrleagrvlvNdpltgvpalpfgGvkesgi-----------------------------------
00403161   1/1  ndteygltaavftrdlaralrvarrleagrvlvN------------------------------------
00371931   1/1  laralrfarrleagrvlvNdsttgadvglpfgGvke----------------------------------
00372771   1/1  ftrdleralrvallsarrleaGrvyvNdsttgav------------------------------------
00350031   1/1  sttgadvgalpfgGvktsglgreggpvgleeftn------------------------------------
00416701   1/1  lrfarrldagivyvNas......lpfggvkesGl------------------------------------
00477581   1/1  ----------------------------------------------------------------------
00448831   1/1  raerfarevdagrvlvNast......pfggvkes------------------------------------