[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA57113.1


[Show Plain Result]

## Summary of Sequence Search
   1::228
   1::220  1.6e-37 31.1% 0037943 00379431 1/1   lo-dependent phosphatases               
  12::209  2.4e-35 34.8% 0045823 00458231 1/1   lo-dependent phosphatases               
  12::208  6.9e-33 32.0% 0046803 00468031 1/1   lo-dependent phosphatases               
  12::211  7.8e-32 30.8% 0049330 00493301 1/1   lo-dependent phosphatases               
  12::221    1e-31 31.8% 0053225 00532251 1/1   lo-dependent phosphatases               
  12::193  3.3e-29 31.5% 0049342 00493421 1/1   lo-dependent phosphatases               
  13::211  6.7e-20 25.8% 0041478 00414781 1/1   lo-dependent phosphatases               
  13::211  3.7e-17 30.1% 0049468 00494681 1/1   lo-dependent phosphatases               
  13::215  1.1e-15 27.0% 0051479 00514791 1/1   lo-dependent phosphatases               
  15::217  1.2e-15 26.9% 0051021 00510211 1/1   lo-dependent phosphatases               
  12::216  2.6e-12 22.5% 0053347 00533471 1/1   lo-dependent phosphatases               
  12::216    5e-11 27.4% 0043485 00434851 1/1   lo-dependent phosphatases               
   9::216  3.2e-08 27.3% 0051688 00516881 1/1   lo-dependent phosphatases               
  12::92   1.5e-06 29.9% 0051159 00511591 1/1   lo-dependent phosphatases               
  15::92   4.1e-05 26.3% 0049880 00498801 1/1   lo-dependent phosphatases               
   1::228


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MRFKRFSKNLAGKDYVVGDIHGTYSLLAQALERVGFDPSQDRLFAVGDLVDRGPESPDALTWLEYPWFHS
00379431   1/1  illkepnlleldmriaviGDiHgqlddllallekigfdppvdllvflGDlvdrgpdslevlrlllslpvi
00458231   1/1  -----------ldrvlklvlipvlrlltlpllfillglldldlliehlkkegllpeedllklldeakeil
00468031   1/1  -----------llllslllslldllielllklkllseeellllllkakeillkepnllelsmriyviGDi
00493301   1/1  -----------lllldpllllelilslldllielllklkllseeellllllkakeilksepnllelsmri
00532251   1/1  -----------sdslilllldllielllllkllseeelllllleakeilkkepnllelsmriyviGDiHG
00493421   1/1  -----------ldgprllllslilslldllielllklkllseedllllleeakeilkkepnlleldlpev
00414781   1/1  ------------MkiavisDiHGnlealeavledieellelaagvdllvflGDlvdrgpdprevlellre
00494681   1/1  ------------pmrilvisDlHggldalerllellgal.kpdlvlflGDlvdrgppslevlgllfllll
00514791   1/1  ------------mrilvisDlHlggnlaallellkellaelkpdlvlflGDlvdrg..vlellkelgipv
00510211   1/1  --------------nkiMlvisDlHlgleepglsrgvdsplaalerllellnallekpdlllllGDlvdr
00533471   1/1  -----------ppgldgpmrilhisDlHlglaalerllelairee.kpDlvlflGDlvdggppsedyrkl
00434851   1/1  -----------mkilvisDlHggldalealldllree.kvdlvihlGDlvdggp..lellrelgip.vva
00516881   1/1  --------mlmmkilviSDlHgnlralelleallellkal.kvdlvihlGDlvdgg..vlellkal.gip
00511591   1/1  -----------lpsaddpmrilhisDlHggdgllallealleli...ekpDlvlilGDlvydrgvgddsl
00498801   1/1  --------------lllmmmrilhisDlHlgldaleallelandl.gpDavvlaGDltdrgsvpaeyaal


                         -         -         *         -         -         -         -:140
query           CRGNHDEFVINAQNLEFDAAWWILVNGGEWWLDLDLTTRNLFSERFKQLPFAMEIETDQGKVGIVHADVP
00379431   1/1  lvrGNHelmllnaly.gfllevkwkylggletllllglgaellkelldwlralplallvlvdggkillvH
00458231   1/1  kkepnllelsmrivviGDiHGqlddLlrllekigfppe.drlvflGDlvDrGpdslevlelllalkikyp
00468031   1/1  HGnlddLlallekigfppe.drlvflGDlvdrGpdslevlelllalkllypdnvillrGNHElmllngly
00493301   1/1  vviGDiHGqlddLlrllekigfppe.drlvflGDlvdrGpdslevlllllalkllypdnvfllrGNHElr
00532251   1/1  nlddLlallekigfppe.drlvflGDlvdrGpdslevlelllalkllypdnvvllrGNHElmllnglyg.
00493421   1/1  mriyviGDiHGnlddLlrllekigfppetdrlvflGDlvDrGpdslevlelllalkllypgnvfllrGNH
00414781   1/1  lkkgigvvvvrGNhDeallkllegfegedlldllallrggletlkstgelldeehlewlrslplylvlgi
00494681   1/1  ellkklgipvylvlGNH.............................dlllgdlleelldllpl.lalilg
00514791   1/1  .ylvlGNHDf..................................qlewleelllaae....glrillvHg
00510211   1/1  gpeslevlellralgipvylvlGNHDfylglslll...........................lewleell
00533471   1/1  ydevlellralkagvpvyv.vlGNHDfdnglsleglrdflaelgfpvlpanvldgfg............g
00434851   1/1  vlGNhDfllllevlle........................dilelldllpealvlelgglrilltHgppl
00516881   1/1  viavrGNhDfl.............................lglellellallpeylvleigglkillvHg
00511591   1/1  eeldellellrklaagip.vyv------------------------------------------------
00498801   1/1  lellselgvp.vlavpGNhDap------------------------------------------------


                         +         -         -         -         -         *         -:210
query           ANLNWTRFVAEIERGNPAIHKYALWSRSRATGKCTTPVEGIERVYCGHTVIKGGTLKIVGNVYFIDTGAA
00379431   1/1  gglspsli........epleeqlledllwsdplfgedaleeflkrngldlvvrGHthvpegyrl..ggli
00458231   1/1  gnvfllrGNHElrllnglyg..........fgdetlekygedlyeeflewlrslPlaavi...ggkilf-
00468031   1/1  g..........fldellrkygaelleelldwlrslplaavi...ggkilfvHgGlspdlplldqirei--
00493301   1/1  llnglyg..........fgdetlrkygaelweefldwlrslplaavig...gkilcvHgGlspdlllldq
00532251   1/1  .........fgdetlrkygaaelwdelldwlrslplaalig...gkilfvHgGlspdlslldqireinrp
00493421   1/1  Elmllngl..........ygfldellrkygaelyeefldwlrslPlaavig..-----------------
00414781   1/1  ggkkillvHgsprslldylllptqdps.......alldlraef........ldadvvvvGHthvp..lve
00494681   1/1  glrillvHgplspd.............................ldllery.gvdlvlsGHtHvpqgve..
00514791   1/1  pl.....................ggllggaeallelleey..gvdlvlsGHtHvpqivel..ggtlvinp
00510211   1/1  aaleldg..lvilltHgplypsldlllq.................lgaealldllkryg.vdlvlsGHtH
00533471   1/1  lyyvfeigg..vrivvlggltprdddldqlewlerelaelrasgadwvivlsHhppygsgldgsdgylag
00434851   1/1  pd.............................llllarelgvdlvlfGHtHr..pqvvevggtlvvnpGsv
00516881   1/1  hlldvlv...................dpeallalarel....dadvvisGHtHrpl..ieelggvlvinP
00511591   1/1  ----------------------------------------------------------------------
00498801   1/1  ----------------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YTFLGARLTLLPLAYQQS----------------------------------------------------
00379431   1/1  tidsgsvygg------------------------------------------------------------
00458231   1/1  ----------------------------------------------------------------------
00468031   1/1  ----------------------------------------------------------------------
00493301   1/1  i---------------------------------------------------------------------
00532251   1/1  lriplegllld-----------------------------------------------------------
00493421   1/1  ----------------------------------------------------------------------
00414781   1/1  l---------------------------------------------------------------------
00494681   1/1  l---------------------------------------------------------------------
00514791   1/1  Gsvgg-----------------------------------------------------------------
00510211   1/1  rpqivvl---------------------------------------------------------------
00533471   1/1  realld----------------------------------------------------------------
00434851   1/1  glplgg----------------------------------------------------------------
00516881   1/1  Gsvggp----------------------------------------------------------------
00511591   1/1  ----------------------------------------------------------------------
00498801   1/1  ----------------------------------------------------------------------