[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA57138.1


[Show Plain Result]

## Summary of Sequence Search
   1::510
  13::115  1.9e-11 27.2% 0044920 00449201 1/1   Sulfiredoxin                            
  11::168    2e-10 26.2% 0044819 00448191 1/1   Sulfiredoxin                            
   1::510


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MTAPDESAQVHGISRVDVTHIHHYSRNPRRQQNPEYDRIKASIRAEGLDQPLVLSQEPGTSDYVLHSGGN
00449201   1/1  ------------ivelpldklvpnplnprlvldpeeleelaesikelgllqPivvrpld..gryeiiaGe
00448191   1/1  ----------islelvplekLrpnklnPrelvdeerveelaesIrefGliqPIvvlklleddgtyliid.


                         -         -         *         -         -         -         -:140
query           TRLKILKDLFEETGDDRFRWVNCVIKPWSQESNLLFAHLRENELRGALPFIDKALAVFDAKALLEKELAV
00449201   1/1  r.Rlraakllglee.......ipvivrdldde.ealalalieNlq-------------------------
00448191   1/1  GhhRlrAakkLglkk.......vPvvvldyldesvsvstWrsgvpfgveqalalalaenlqvieddkvRe


                         +         -         -         -         -         *         -:210
query           ETLSQRQLEELFRERGFGLSHSMISKMGYAVDTLWPVMPKALAAGLGRPQVEKIRALERAAREIWDRRQL
00449201   1/1  ----------------------------------------------------------------------
00448191   1/1  nlelieialallgllelalpgelllrqe------------------------------------------


                         -         -         -         +         -         -         -:280
query           GEDMDFNAVFLELCRRHDCSEWDIQPLRDALENEIADESEQNRQVVYLEMEAQLSGRPFDFVSQPVEGEE
00449201   1/1  ----------------------------------------------------------------------
00448191   1/1  ----------------------------------------------------------------------


                         -         *         -         -         -         -         +:350
query           EEQGGTSDKVCRQEKNQSADIDPVNGSSLGREPKPTQPLDSNKPNGESGAKTPAPEFTQNRKTSLTSRDL
00449201   1/1  ----------------------------------------------------------------------
00448191   1/1  ----------------------------------------------------------------------


                         -         -         -         -         *         -         -:420
query           RSLRAQLWECAAALAEHHGLGEAVIQLKDQGLGLLLVEVPPQELIDTLDPDMLGLVSALWWQLAASAELT
00449201   1/1  ----------------------------------------------------------------------
00448191   1/1  ----------------------------------------------------------------------


                         -         -         +         -         -         -         -:490
query           VAPIDIVLHYLNKSSALHEALASHDAGLLFSSVWTPDPGHMSSLLWQQLNPPDWQVLLRMMETYRAIKRL
00449201   1/1  ----------------------------------------------------------------------
00448191   1/1  ----------------------------------------------------------------------


                         *         -         -         -         -         +         -:560
query           AYDTGIELWVPIAGGGNVIQ--------------------------------------------------
00449201   1/1  ----------------------------------------------------------------------
00448191   1/1  ----------------------------------------------------------------------