[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA57493.1


[Show Plain Result]

## Summary of Sequence Search
   1::218
   4::210  5.6e-21 21.3% 0045677 00456771 1/1   yme-like                                
  49::214  7.9e-16 21.3% 0042970 00429701 1/1   yme-like                                
  20::150  5.5e-05 24.4% 0043002 00430021 1/1   yme-like                                
   1::218


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEYETSRRIFYPPIKYCFIILFLLSLLTGCASTPPASTANLCVIFEKQPEWYDYAKESEKKWGTPTPILM
00456771   1/1  ---slslllllllldtlgllallllllglavlglvaskaladallarllpylplieeaakrygvppalla
00429701   1/1  ------------------------------------------------ekyldlikkaakkygvppalll
00430021   1/1  -------------------llllllllalaaaagagfedwlaglralalaagvseatldaalaglkydpr


                         -         -         *         -         -         -         -:140
query           AFIHRESSFRGDARPPRRWFLGFIPLPRSSSAYGYGQIQDPAWEDYLGANGGWFKSRADMEDVLDFIGWY
00456771   1/1  AiarqESgfnpnavs.........pwgngagavGlmQimpatarel.glpgs.vddlldpedniragary
00429701   1/1  aiarqESgfnpnavspag.............avGlmQvmpataralgkllglsyggsvddlfdpetnira
00430021   1/1  virldrgqaeftlalsplgllkslleylgrrlsearvarglaflakyaallrraekkygvppellaAiig


                         +         -         -         -         -         *         -:210
query           NHISARRLGISKRNPEHLYLAYHEGHRGYQRGAWRRKPHLRRVAKRVARQARMYGSQLKSCEDRFKCRKF
00456771   1/1  lrrlldrfg...gdwdlyfalaaYNaGpgrvlr..algrp........pfaetrdYvkkvlalaqlyknp
00429701   1/1  garylrdlldrf...ggdwllalaaYnaGpgrvrralglagrgldpllflelipfketrdYvkkvlayyl
00430021   1/1  vESrfgpyag------------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           YQFWPFCR--------------------------------------------------------------
00456771   1/1  ----------------------------------------------------------------------
00429701   1/1  iyrl------------------------------------------------------------------
00430021   1/1  ----------------------------------------------------------------------