[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA57498.1


[Show Plain Result]

## Summary of Sequence Search
   1::193
   4::194  1.2e-55 46.5% 0052322 00523221 1/1   edoxin-like                             
   9::193  3.8e-36 29.5% 0048804 00488041 1/1   edoxin-like                             
   8::191    3e-34 31.8% 0050002 00500021 1/1   edoxin-like                             
   8::188  4.1e-33 36.4% 0048298 00482981 1/1   edoxin-like                             
   8::170  5.4e-32 32.9% 0051602 00516021 1/1   edoxin-like                             
   6::176  4.4e-31 33.3% 0049009 00490091 1/1   edoxin-like                             
   5::189  1.9e-30 32.0% 0048990 00489901 1/1   edoxin-like                             
   1::157    3e-30 37.0% 0048908 00489081 1/1   edoxin-like                             
   8::165  8.6e-30 35.4% 0051125 00511251 1/1   edoxin-like                             
   9::137  6.3e-29 42.4% 0051923 00519231 1/1   edoxin-like                             
   8::164  1.1e-28 36.7% 0052340 00523401 1/1   edoxin-like                             
   8::193  2.4e-28 29.5% 0050915 00509151 1/1   edoxin-like                             
   8::170  2.7e-28 33.3% 0046445 00464451 1/1   edoxin-like                             
   9::174  3.1e-28 32.9% 0050456 00504561 1/1   edoxin-like                             
   1::159  3.6e-28 36.1% 0048812 00488121 1/1   edoxin-like                             
   1::161  4.6e-28 34.7% 0051123 00511231 1/1   edoxin-like                             
   8::162  1.1e-26 35.9% 0051703 00517031 1/1   edoxin-like                             
   5::188  4.6e-26 32.5% 0050770 00507701 1/1   edoxin-like                             
  15::161  4.6e-26 42.0% 0052802 00528021 1/1   edoxin-like                             
  11::164  8.8e-25 38.2% 0043753 00437531 1/1   edoxin-like                             
  13::168  2.6e-24 31.8% 0051667 00516671 1/1   edoxin-like                             
   7::159    3e-24 34.0% 0047173 00471731 1/1   edoxin-like                             
  10::166  3.1e-24 34.5% 0050985 00509851 1/1   edoxin-like                             
   7::163  5.2e-24 33.1% 0049667 00496671 1/1   edoxin-like                             
  10::148  5.6e-24 39.1% 0047310 00473101 1/1   edoxin-like                             
   9::167  7.1e-24 33.8% 0048388 00483881 1/1   edoxin-like                             
   3::163  1.7e-23 31.8% 0041935 00419351 1/1   edoxin-like                             
  14::164  3.2e-22 38.0% 0051671 00516711 1/1   edoxin-like                             
   8::165  1.5e-21 36.4% 0039527 00395271 1/1   edoxin-like                             
  15::168  3.1e-21 38.1% 0052893 00528931 1/1   edoxin-like                             
   7::145  2.4e-19 36.2% 0043030 00430301 1/1   edoxin-like                             
  13::137  8.3e-19 30.6% 0052617 00526171 1/1   edoxin-like                             
  12::137  1.1e-18 39.1% 0048033 00480331 1/1   edoxin-like                             
   5::137  1.6e-18 38.8% 0040163 00401631 1/1   edoxin-like                             
  14::186  1.6e-18 30.5% 0052983 00529831 1/1   edoxin-like                             
   1::153  1.7e-18 31.7% 0051504 00515041 1/1   edoxin-like                             
   8::137  2.2e-18 37.2% 0041722 00417221 1/1   edoxin-like                             
  16::137  2.3e-18 44.0% 0051497 00514971 1/1   edoxin-like                             
   7::159    2e-17 30.3% 0052012 00520121 1/1   edoxin-like                             
  10::137    2e-17 35.3% 0042825 00428251 1/1   edoxin-like                             
  13::137  6.7e-17 33.9% 0038196 00381961 1/1   edoxin-like                             
  10::137  9.7e-15 33.9% 0051931 00519311 1/1   edoxin-like                             
  10::166  7.2e-12 33.3% 0049857 00498571 1/1   edoxin-like                             
   7::137  1.1e-10 35.4% 0050950 00509501 1/1   edoxin-like                             
  12::137  1.5e-09 34.8% 0049633 00496331 1/1   edoxin-like                             
  11::137    2e-09 33.0% 0049377 00493771 1/1   edoxin-like                             
  20::137  7.3e-09 35.3% 0049496 00494961 1/1   edoxin-like                             
  11::137  7.6e-09 38.3% 0051129 00511291 1/1   edoxin-like                             
   9::166  1.5e-08 28.6% 0051914 00519141 1/1   edoxin-like                             
  17::137  3.9e-08 30.0% 0046603 00466031 1/1   edoxin-like                             
  11::137    6e-08 38.7% 0046733 00467331 1/1   edoxin-like                             
  24::137  1.2e-07 31.2% 0048529 00485291 1/1   edoxin-like                             
  16::153  2.9e-07 28.4% 0050672 00506721 1/1   edoxin-like                             
  14::137  3.6e-07 31.9% 0048146 00481461 1/1   edoxin-like                             
  21::137  4.9e-07 32.9% 0049048 00490481 1/1   edoxin-like                             
  10::137  7.1e-07 35.1% 0049089 00490891 1/1   edoxin-like                             
  18::137  7.7e-07 31.8% 0046295 00462951 1/1   edoxin-like                             
  16::137  1.2e-06 29.7% 0045739 00457391 1/1   edoxin-like                             
   6::137  1.7e-06 28.0% 0050108 00501081 1/1   edoxin-like                             
  15::169  1.8e-06 25.0% 0052451 00524511 1/1   edoxin-like                             
   7::137    2e-06 30.9% 0051911 00519111 1/1   edoxin-like                             
  17::137  4.3e-06 30.7% 0053106 00531061 1/1   edoxin-like                             
  35::137  5.8e-06 36.1% 0037474 00374741 1/1   edoxin-like                             
  16::137  8.9e-06 30.3% 0046982 00469821 1/1   edoxin-like                             
  20::149  8.9e-06 30.3% 0039300 00393001 1/1   edoxin-like                             
  18::136  1.4e-05 23.9% 0035499 00354991 1/1   edoxin-like                             
  36::141  2.1e-05 26.0% 0037704 00377041 1/1   edoxin-like                             
  17::137  2.6e-05 29.2% 0049632 00496321 1/1   edoxin-like                             
  29::136  5.6e-05 28.2% 0045740 00457401 1/1   edoxin-like                             
  40::140  0.00012 23.9% 0042775 00427751 1/1   edoxin-like                             
  28::136  0.00019 29.1% 0039301 00393011 1/1   edoxin-like                             
  37::137  0.00028 31.9% 0040838 00408381 1/1   edoxin-like                             
  41::136   0.0003 31.9% 0051595 00515951 1/1   edoxin-like                             
  19::138  0.00046 21.4% 0037799 00377991 1/1   edoxin-like                             
   8::137  0.00068 28.0% 0053013 00530131 1/1   edoxin-like                             
   1::193


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MARTESMMLDLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALSQFAREYQPKG
00523221   1/1  ---llsplllvgdpapdftlpdl.dGktvslsdlkG.kvvlvvfwatwCppCkaelpeleelaeeykd.g
00488041   1/1  --------llvGdpaPdftlpd.ldGk.vslsdlkgdkvvvlffyPatfcpvCttelpalaeladefkak
00500021   1/1  -------GllkvgdpaPdftltd.ldgkgeflpvslsdlkG.kvvllffwPatwCpvCptelpalaelyd
00482981   1/1  -------sl.vgdkapdftlpalldtdgktvslsdlkG.kvvvlffwPatwcpvCttelpalaelydefk
00516021   1/1  -------ll.vgdkapdftlpd.ldgktlllldvslsdllkg.kvvvlffwPatwcpvCttelpalaela
00490091   1/1  -----sgmllvgdpapdftltd.ldgkgelltvslsdlkG.kvvllffwPatwCpvCptelpalaelyee
00489901   1/1  ----vgmmllvGdpaPdftlpavvdtdgktvslsdfkGk.vvvlffyPadftpvCttelpalaelaeefk
00489081   1/1  tlllllllvslagalllvgdpapdftltd.ldgktvslsdlkGkvvllffwpaswcpvCttelpalaela
00511251   1/1  -------lllvgdpapdftltdl.dgkpvslsdlkgdkvvllffwPatwCpvCttelpalaelaeelkdk
00519231   1/1  --------llvgdpaPdftlpvldldgktfsladlkg.kpvlvnFwatwCppCkaelpeleelaeeykd.
00523401   1/1  -------lllvgdpapdftltdl.dgktvslsdllkkg.kvvllffwPatwCpvCttelpalaelaeelk
00509151   1/1  -------mllvgdkaPdftlpdt.dgefltvslsdlkgkwvvLffyPadfTpvCttelpeladlyeefkk
00464451   1/1  -------Gallvgdkapdftltalledldgktvslsdlkg.kvvllffwPatwCpvCptelpalaelyde
00504561   1/1  --------slvgdpapdftltdl.dgklellpvslsdlkG.kvvllffwPatwCpvCptelpalaelaee
00488121   1/1  llllllllvlllgalllvgdpapdftltd.ldgktvslsdlkG.kpvllffwatawcppCptelpalael
00511231   1/1  alvlllglaldlvgalllvgdpapdftltd.ldGkpvslsdlkG.kvvllffwpaswcpvCttelpalae
00517031   1/1  -------slplllvgdkapdftlpdl.dgktvslsdllkg.kvvvlnFiyPatwCpvCttelpalaelye
00507701   1/1  ----lmmmllvGdkaPdftlptt.dgefktvslsdlkG.kwvvLffyPadfTpvCttelpafadlydefk
00528021   1/1  --------------lPapdftlvd.ldgetvslsdlkg.kpvlvdfyaswCppCktelpaleelaeelkd
00437531   1/1  ----------vgdpapdfeltdl.dgkevslsdlkg.kpvlldfyaswCppCkteapeleelaeelkdkg
00516671   1/1  ------------dpapdftltdl.dgkglltvslsdlkG.kvvllffwPatwCpvCptelpalaelydel
00471731   1/1  ------msllvgdkaPdftlltdldgktvslsdllkgkvvvlffyPaafcpvCtte..hlpalaeladef
00509851   1/1  ---------kvgdpaPdftlpalvldlgllldldgkplsledvslsdllkg.kvvvlffyPatwcpvCtt
00496671   1/1  ------lmsllvgdkaPdftllallpdtdgktvslsdlfkgkkvvlffyPaaftpvCttehlpaladlad
00473101   1/1  ---------Aevgdpap.fslkdl.dgetlevslsdlkg.kpvlvdfwatwCppCkaeapeleelaeelk
00483881   1/1  --------lkvgdkaPdftlpalldldgktvslsdllkg.kvvvlffyPaaftpvCttehlpalaelade
00419351   1/1  --aaaltllevgdpapdftltd.qdGktvslsdlkG.kvvllyfyatwcppvCptelpeladlykklkdk
00516711   1/1  -------------slPalpdftlvdl.dgetvsladlkg.kpvlvdfyaswCppCkaeapeleelaeel.
00395271   1/1  -------lllvgdpapdft.ltdldgkevslsdlkg.kpvlvdfyatwCgpCkaeapeleelakelkdkg
00528931   1/1  --------------AP.ftltd.ldgktvslsdlkG.kvvllffwatwcppvCptelpalaelyeelkdr
00430301   1/1  ------malvtllglallllgellkvgdkaPdftlv.dldgeevslsdfkg.kkvvlffyPadftpvCtt
00526171   1/1  ------------ksapdftlpdlldgepvslsdlrGkvvLlvfwas.wCgpcpkeypgleelyekygdkg
00480331   1/1  -----------Gdpapdftlvdl.dgetfdladl.kgkpvlvdfwatwCppCkaeapvleelaeelk..g
00401631   1/1  ----lllsllvgkpapdfslvdl.dgenfdlavlkgk.pvlvdfwaswCgpCkalapvleelakey...g
00529831   1/1  -------------kaPdftlpavlldtdgktvslsdlkggkkvvlffypadftpvCttelpafadlydef
00515041   1/1  lllllrlllllkslllllllllallvgdpapdftlpdl.dgkvvslsdnFdelkg.kpvlv.Ffgll..W
00417221   1/1  -------lllvgdpapvfeltdl.dgeevvlsdlk.gkpvlvyFwaswCppCkalapvleelaekykdek
00514971   1/1  ---------------Pdftlkdl.dgetvsladlkg.kpvlvdfwatwCppCraelpaleelaee....g
00520121   1/1  ------llllllllllvllagmlllvgdkapdftlt.dtdgktvslsdlkgk.wvvlffyPatftpvCtt
00428251   1/1  ---------lvgkpapdfslvdl.dgeefdlavlkgk.pvlvdFyaswCgpCkalapvleelaeelkgek
00381961   1/1  ------------qsapdftltdlldgkpvslsdlkGkvvllvfva.swCglcrpeypeLeelyekykdkg
00519311   1/1  ---------eigklapdftltd.qdGktvtlsdlkG.kvvllyfgftdCpdvCpteladlaelyeelkdl
00498571   1/1  ---------aegqpapdfvvlltldgfalaladlsgk.pvlvdfwaswCgpCkalapeleelaeeyklld
00509501   1/1  ------lllevgkpapdfsvvdl.d.enfdlavlkgk.pvlvdfyapwCgpCkalapvleelaeel..kg
00496331   1/1  -----------aegkpapdfsvvel.tgenfdlavlkgk.pvlvdfwapwCgpCkalapvleelaeelkg
00493771   1/1  ----------Llglaappvtlldl..gealelallsgk.pvlvdfyapwCgpCkalapeleelaeeyk.g
00494961   1/1  -------------------svveltgeanfdlallegk.pvlvdfyapwCgpCkalapvleelaeel..d
00511291   1/1  ----------aglpapdvvlltld.gfdelladlsgk.pvlvdfyapwCgpCkalapvleelaeelkd.g
00519141   1/1  --------lsellalpdfsvvel.tgenfdlalle.gkpvlvdfyapwCgpCkalapvleelaeelkgkg
00466031   1/1  ----------------dlsvieltglenfdlallkakaegkpvlvdfyapwCgpCkalapvleelaeelk
00467331   1/1  ----------lgapapdvvll.tldgfdelladlsgk.pvlvdfyapwCgpCkalapvleelaeel..dg
00485291   1/1  -----------------------adlvlllldgnffelvllsg.kpvlvdFwApWCgpCkaeapileela
00506721   1/1  ---------------lpavtlltldgfeealadlsgk.pvlvdfwaskdeegeswCgpCkalapvleela
00481461   1/1  -------------dlPafsgavveltgenfdlal.asgkpvlvdfyapwCgpCkalapvleelaeeykgl
00490481   1/1  --------------------avieltgenfdlallk.gkpvlvdfwapwCgpCkalapvleelaeelkd.
00490891   1/1  ---------lslpaapdftvvel.tgenfdlall.sgkpvlvdfyapwCgpCkalapvleelaeel..pg
00462951   1/1  -----------------lsvveltgenflslvllsg.kpvlvdfwapwCgpCkalapvleelaeelkd.g
00457391   1/1  ---------------lspvleltdlnfldevlsdlsg.kpvlvdfyapdwCgpCkalapvleelaeeykg
00501081   1/1  -----llllllllalapevlllsleefeellkdlk.gkpvvvdfwasddetgksWCppCkalaPvleela
00524511   1/1  --------------sspvveltlenfdelvld...sgkpvlvdfyapwCgpCkalapvleelakeykdlg
00519111   1/1  ------Llslllgapapsf.vvel.tgenfdelvlksgkpvlvdFyapwCgpCkalapvleelaeeykgl
00531061   1/1  ----------------pvvvlltlenfdelladls.gkpvlvdfyapwCgpCkalapvleelaeeykd..
00374741   1/1  ----------------------------------vleltddnflelvlksgkpvlvdfyapwCgpCkala
00469821   1/1  ---------------lpvvvlltlenfdelladlk.gkpvlvdfwapwCgpCkalapvleelaeel..dg
00393001   1/1  -------------------llldgnvkeltdenfeellksgkpvlvvfyapwCpyCkrlkplleelaeey
00354991   1/1  -----------------vellegkdfdvvlgs..asgkpvlveFfapwCphCkalapvleelaeel.pdk
00377041   1/1  -----------------------------------sgklvvvvfyapwCphCkalkplleelaeelpg.d
00496321   1/1  ----------------sgpvieltdenflelvllsgk.pvlvdfwapwCgpCkalapvleelakelkd.g
00457401   1/1  ----------------------------ltdeefeelvknldgkpvvvvFyapwCpyCkalaplleelae
00427751   1/1  ---------------------------------------vlvdFyapwCgpCkklapvleelaeelkd.k
00393011   1/1  ---------------------------eltdenfeelvlksgkpvvvvFyapwCpyCkalaplleelaae
00408381   1/1  ------------------------------------pviellsldffdevleslkgkpvlvdfyapwCgp
00515951   1/1  ----------------------------------------liellelvsvvklltleeleellksgkpvv
00377991   1/1  ------------------alltegkdytvllgp.psgkpvvveFfaywCphCkkfeptlevleklakklp
00530131   1/1  -------lllllllplllllllssgvveltdanfdelvldsgkpvlvdfwapwCgpeCkalapvleelae


                         -         -         *         -         -         -         -:140
query           LAIVGISVNDVENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAACTPDFFLFDKNHKLVYRGQF
00523221   1/1  vvvvgvsvndfgnqeddspeelaafaekygltfplllDedgevakaygvrgtPttflidkdGkvvyrgvg
00488041   1/1  gvevvgvsvddpfdhkaflkkygalfdealllglpfpllsDpdgevakaygvliekdglgfgyllalrat
00500021   1/1  efkdkgvevvgvsvddpfdhpaf.lkeylkffglyglpfpllsDpdgelakaygvlvgylglalpatfli
00482981   1/1  dkgvevlgisvdd....pedhkaflkkyaklfglnfpllsDpdgevakaygvlggllgralpatflidpd
00516021   1/1  delkdkgvevvgisvddpfdhkaf.lkkylklfglgglpfpllsDpdgelakaygvlvekglglpatfli
00490091   1/1  lkdkgvevvgvsvddpfdhpaf.leeylkffglnglpfpllsDpdgelakaygvlggylvlalpatflid
00489901   1/1  klgvevlgvsvDspfshkafl.kkivelfglgglnfpllsDpdgevakaygvlielgglalratflidpd
00489081   1/1  eelk..gvevvgvsvdd........pealkaflekfgldnfpllsdfpdgelakaygvlledggylvlhl
00511251   1/1  gvevlgvsvdd........pevlkaflekfglpfpllsdivpdgelakaygvlvekglvalpatflidpd
00519231   1/1  gvvvvgvnvdll..geedspealkkflkelgldfpvlldedgelakaygvrgtPttflidkdGkiva---
00523401   1/1  dkgvevvgvsvdd........pealkaflekfglpfpllsdpdgelakaygvllegllgylvlglpatfl
00509151   1/1  lgvevlgvSvdsvfshkawa.ekikefgglgglnfpllsDpdgevakaygvllekellgkglglavRatf
00464451   1/1  lkdkgvevlgvsvddpfdhpa.flkeyleffglgglnfpllsdpdgelakaygvlvgylvlglpttflid
00504561   1/1  fkdkgvevvgvsvdd....pedhkaflkkygalfglnfpllsDpdgelakaygvlvgylglalpatflid
00488121   1/1  aeelk..gvevvgvsvdd........pealkaflkkfgllnfpllsdvpdgelakaygvlggylglalpa
00511231   1/1  laeel...gvevvgvsvdd........pevlkaflekfglpnfpllsdpdgelakaygvlledggygvlh
00517031   1/1  efkdk.vevvgisv........dspevlkaflkklglnfpllsDpdgelakaygvlggllglalpatfli
00507701   1/1  klgvevigvSv........DspfshkawaetikelgklglpfpllsDpdgevakaygvliekggllalRa
00528021   1/1  kgvvvlgvsvdsf..perdspeelkefleklgvlnfpllsdengelakaygvlgiPtlflidkdGkvvar
00437531   1/1  vvvvgvsvd.......dspeslkaflkkyglpfplladengelakaygvlgiPtlflidkdGkvvaryvg
00516671   1/1  kdkgvevlgvsvddpfdhpaf.lkeylkffglgglnfpllsdpdgelakaygvlggylglalpatflidp
00471731   1/1  kklgvevvlgvsvdd........pevlkafaeklglpnnfpllsDpdgevakaygvliekdllgleylgl
00509851   1/1  v..elpalaeladeflkdkgvlevvgvsvd........spevlkaflkklgllpfpllsDpdgelakayg
00496671   1/1  efkklgvdevlgvsvdd........pfvhkafleklglpnkfpllsDpdgevakaygvlveksglgllvr
00473101   1/1  eddgvvvvgvsvd.......dspelakkfvegyp.tfplllsdgdvvgelagaygvlglpttflidkdlg
00483881   1/1  fkalgvlevvgvsvdd........pevlkafaeklgldpfpllsDpdgevakaygvlieksglgllvlgl
00419351   1/1  gkdvevlgvsvd.....perdtpeelkaflkkfgltfplligltgdladdldkalakaygvlyekkglgy
00516711   1/1  .dgvvvvgvsvd.......dspelakkflgvfglptfpllsdpggevaraygvlalpttflidpdgkvar
00395271   1/1  vvvvgvdvden......speelkaflkkfgltfplllgdvdgilagelakaygvrgiPtlflidkdGkvv
00528931   1/1  lladgvevlgvsvd.....perdspealkaflekfglpfplltgksdvdgelakaygvllkkeglgllld
00430301   1/1  eapefnelaeel.k.gvevlgvsv........dspfshkafaekeglnfpllsDplrngelakaygvlge
00526171   1/1  lvvlgvpcdqfggqepgsneeikeflkyvrpglkygvtfpllakidvnganahplykflkaalggll---
00480331   1/1  vvvvgvdvd.......dnpealkkfleklglpfpllsdpdgalakaygvrgiPttflidkdGkivar---
00401631   1/1  vvvvkvdvd.......dsaeevkeflkkyglpfpvllgdengelakkygvrgiPtlflfdkdGkvva---
00529831   1/1  kkkgvevlgvsvd........spfshkaflkkylklfglgglnfpllsDpdgevakaygvllekglalra
00515041   1/1  CgpCkalapvl.elaeelkd.gvvvvkvdv.......denpelakkflekgvlgfPtlldfkgglavayg
00417221   1/1  gvvvvkvdvd.......dnpeelkeflkklglpfpllldpdvlgelakaygvrgiPtlvlidkdGkv---
00514971   1/1  vvvvgvnvd.......dspeavkaflkelglpfpvllldpdgelakaygvrgiPttflidkdGkiva---
00520121   1/1  elpafaelydefkdlgvevlgvSv........Dspfdhkaflkkylklfglnfpllsdpdgevakaygvl
00428251   1/1  gvvvvkvdvdenr.......dtlkkflkklglpfpllldpdvikelakaygvrgiPtlflfdkdGkv---
00381961   1/1  lvvlgfpcnqfgsqepgsneeilefckvvkfllkygvtfplfekidvnGenahplykflkealpgll---
00519311   1/1  lgddvqvlfvsvD.....perdtpevlkeyaekfgpdfpgltgdpeeikelakaygvyyekvglgdv---
00498571   1/1  gvvvvkvdvddrp.........................dengelakkygvrgiPtlvlfdkdGkivaalr
00509501   1/1  vvfvkvdvden.............................pelakrygvrgvPtlllfd.nGkevar---
00496331   1/1  ..vvfvkvdvden.............................pelakkygvrgiP.tlllfkdGkev---
00493771   1/1  nvvfvkvdvdrenpd.............................laqkygvrggliPtlvlfdkdGk---
00494961   1/1  gvvfvkvdv.............................denpelakkygvrgiPtlllfd.nGkeva---
00511291   1/1  vvfvkvdv.............................denpelakrygvrgiPtlllfd.nGkevar---
00519141   1/1  vvfvkvdvdenp.............................elakkygvrgvPtlllfd.dGkevallry
00466031   1/1  g.gvvfvkvdvden.............................pelakkygvrgvPtlllfd.dGke---
00467331   1/1  vvfvkvd.............................vdlenpelakkygvrgiPtlllfd.nGkeva---
00485291   1/1  eeykgkglvvlavs................fllelkvvfvkvdvdenpelakkygvrgiPtlllfk.---
00506721   1/1  keykd.nvvvvkvdvdddee......................lldengelakkygvrgiPtll.kdGkev
00481461   1/1  nkgvvfvkvd.............................vdenpelakkygvrgvPtlllfdnggkl---
00490481   1/1  gvvfvkvd.............................vdenpelakkygvrgiPtlllfd.dgkiva---
00490891   1/1  vvfvkvd.............................vdenpelakkygvrgvPtlllfd.nGkevar---
00462951   1/1  vvfvkvdv.............................denpelakkygvrgiPtlllfd.dgkivar---
00457391   1/1  lgvvfvkvdvd.............................enpelaekygvrgvPtlllfd.dGkev---
00501081   1/1  keykd.dvvfvkvdvdenp......................vlkdpngelakkygvtgiPtllvfk.---
00524511   1/1  lkgdvvfvkvdvd..d..............................lakkygvrgiPtlllfd.nGkeva
00519111   1/1  nkgvvfvkvdvdenp...............................akkfgvrgiP.tlllfkdGke---
00531061   1/1  vvfvkvdv.............................denpelakkygvrgiP.tlllfkdGkevar---
00374741   1/1  pvleelaeeykg.gvvfvkvdv.............................denpelakrygvrgiP---
00469821   1/1  vvfvkvdvden.............................pelakkygvrgiPtlllf.kdGkevar---
00393001   1/1  pglkvvfvkvd.............................vdenpelaekygvrgvPtlvlfk.nGkevg
00354991   1/1  vkfvkvdvdllggpnsllaaraalaaaalgkflklhdalfeaqfeegldlsdlevllkiaaeagld----
00377041   1/1  vvfvkvd.............................vdenpelaekygvrgvPtlvifkng...kyvgal
00496321   1/1  vvfvkvd.............................vdenpelakkygvrgiPtlllf.kdGkevar---
00457401   1/1  eyklllngkvkfvkvd.............................vdenpelaekygvrsvPtlvl----
00427751   1/1  vvfvkvdv.............................denpdlakkygvrgiPtllffkngkevdrlvga
00393011   1/1  ykdlgkgkvkfvkvd.............................vdenpelaekygvrsvPtivlf----
00408381   1/1  Ckalapvleelaeeykd..vvfvkvdvden.............................pelaeryg---
00515951   1/1  vvfgapwCpyCrklapileelaeel...kvkfvkvdvdene.......................ll----
00377991   1/1  ddgkvkvvkvdvplgpnsllaaraaaaakalgkfwklhdalfeaqfeegtnl.dlevllkiakeagld--
00530131   1/1  eypgkgvklakvdv.............................denpelaerfgvrgiP.tlllfkd---


                         +         -         -         -         -         *         -:210
query           DDSRPGNDLPVTGEDLQTAVKAVLSGQPIPNEQRPSMGCNIKWKPGNEPDYFG-----------------
00523221   1/1  dlsrkvl.gevdaeellaaleallaggpvpltqtpsigcsikwkpgdetllldl----------------
00488041   1/1  flidpdGkiryifvgplpvgrnvdellralkalqltdkpgvgcpanWkpgdev-----------------
00500021   1/1  dpdGkvryrf.....vgplspgrlvdeilrllkalq......ltdkpgvvc-------------------
00482981   1/1  Gkiryr.fvgplpvgrlv....dellrllkalq.....lvdklpsvvc----------------------
00516021   1/1  dpdgkiryr.lvgplpvgrlvdellrllka----------------------------------------
00490091   1/1  pdGkvryrf.....vgelsperlvdeilrllkalql----------------------------------
00489901   1/1  Gkiryvf.vgdlpvgrn....vdellrllkalqltdk......hgvvcp---------------------
00489081   1/1  patflidpdGkvvyrfl-----------------------------------------------------
00511251   1/1  Gkvvyrfvgel.....npldlerdi---------------------------------------------
00519231   1/1  ----------------------------------------------------------------------
00523401   1/1  idpdGkvvyrfvgplspveplaee----------------------------------------------
00509151   1/1  lidpdgkvrlilvndvsvgrn.....vdeilrlldalqlt......dkhgvvc-----------------
00464451   1/1  pdGkivyr.fvgpldperlv....deilrl----------------------------------------
00504561   1/1  pdGkvryr.fvgelsperlvd....eilrllkal------------------------------------
00488121   1/1  tflidpdGkvvyrgfvgdl---------------------------------------------------
00511231   1/1  lpatflidpdGkvvylrfvgd-------------------------------------------------
00517031   1/1  .kdgkivyvfvglldplslerl------------------------------------------------
00507701   1/1  tflidpdGkiryvf.vgplpvgrn....vdevlralkalqltdk....----------------------
00528021   1/1  fvgaldpedleelle.....l-------------------------------------------------
00437531   1/1  .........ardadellellekll----------------------------------------------
00516671   1/1  dGkvvyrf.....vgelsperladeilr------------------------------------------
00471731   1/1  alratflid.dgkiryv.l---------------------------------------------------
00509851   1/1  vlveksglglgvrglpatflid.dGk--------------------------------------------
00496671   1/1  glratflid.dgkiryvfvgpdv-----------------------------------------------
00473101   1/1  kivarfvg--------------------------------------------------------------
00483881   1/1  patflid.dgkiryvfvgplpt...gr-------------------------------------------
00419351   1/1  lvdhipttflidpdGkivaryvg-----------------------------------------------
00516711   1/1  yvg...........gldpdellel----------------------------------------------
00395271   1/1  a.......ryvgaldaerdellell---------------------------------------------
00528931   1/1  ylvdhlpatflidpdGkvvarfvgeldp------------------------------------------
00430301   1/1  psllg-----------------------------------------------------------------
00526171   1/1  ----------------------------------------------------------------------
00480331   1/1  ----------------------------------------------------------------------
00401631   1/1  ----------------------------------------------------------------------
00529831   1/1  tflidpdgkiryv.lvgplpvgrn....vdellrllkalqlvdkh.------------------------
00515041   1/1  vgglpatflidal---------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00514971   1/1  ----------------------------------------------------------------------
00520121   1/1  iekglalratflidpdgki---------------------------------------------------
00428251   1/1  ----------------------------------------------------------------------
00381961   1/1  ----------------------------------------------------------------------
00519311   1/1  ----------------------------------------------------------------------
00498571   1/1  yvGa.......ldaeelleflkk.lk--------------------------------------------
00509501   1/1  ----------------------------------------------------------------------
00496331   1/1  ----------------------------------------------------------------------
00493771   1/1  ----------------------------------------------------------------------
00494961   1/1  ----------------------------------------------------------------------
00511291   1/1  ----------------------------------------------------------------------
00519141   1/1  vGal.......daeelleflekllge--------------------------------------------
00466031   1/1  ----------------------------------------------------------------------
00467331   1/1  ----------------------------------------------------------------------
00485291   1/1  ----------------------------------------------------------------------
00506721   1/1  arlvGaldaeele---------------------------------------------------------
00481461   1/1  ----------------------------------------------------------------------
00490481   1/1  ----------------------------------------------------------------------
00490891   1/1  ----------------------------------------------------------------------
00462951   1/1  ----------------------------------------------------------------------
00457391   1/1  ----------------------------------------------------------------------
00501081   1/1  ----------------------------------------------------------------------
00524511   1/1  rlvytg.......artaeelleflekllg-----------------------------------------
00519111   1/1  ----------------------------------------------------------------------
00531061   1/1  ----------------------------------------------------------------------
00374741   1/1  ----------------------------------------------------------------------
00469821   1/1  ----------------------------------------------------------------------
00393001   1/1  .grfvGars-------------------------------------------------------------
00354991   1/1  ----------------------------------------------------------------------
00377041   1/1  d---------------------------------------------------------------------
00496321   1/1  ----------------------------------------------------------------------
00457401   1/1  ----------------------------------------------------------------------
00427751   1/1  ----------------------------------------------------------------------
00393011   1/1  ----------------------------------------------------------------------
00408381   1/1  ----------------------------------------------------------------------
00515951   1/1  ----------------------------------------------------------------------
00377991   1/1  ----------------------------------------------------------------------
00530131   1/1  ----------------------------------------------------------------------