[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA57747.1


[Show Plain Result]

## Summary of Sequence Search
   1::214
  16::213  1.8e-44 34.1% 0037559 00375591 1/1   hrome c oxidase subunit III-like        
  13::213  2.2e-43 33.3% 0040794 00407941 1/1   hrome c oxidase subunit III-like        
  17::213  1.8e-42 33.5% 0042845 00428451 1/1   hrome c oxidase subunit III-like        
  11::213  9.7e-42 32.4% 0041781 00417811 1/1   hrome c oxidase subunit III-like        
   1::214


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSDKHTAVAEQFDDPEQEYHAATLGMWVFLATEVLFFGVLFASYAVSRFNYPEAFAEASRHTDIVLGTIS
00375591   1/1  ---------------edvrsglrlgfwlfllselllFaslfaayfvlr.lspawpplgillldlllplln
00407941   1/1  ------------lhtllvllglrlgmwlfilsEvllFasffwayfvlslsppelflaelgllwpplgiel
00428451   1/1  ----------------lvllglrlgmwlfilsEvllFasffwayfvlslspaelftielgalwpplgiel
00417811   1/1  ----------qglhtllvllglrlgmwlfilsEvllFasffwayfvlslsptvelgavwppvgilpllpl


                         -         -         *         -         -         -         -:140
query           TGVLLTSGFTMALAVRSAKLGRDKAIIGFLVLTILLAIAFLFIEGTEYYQAYGEQLIPAFNFMYEGAHEK
00375591   1/1  TliLlsSsvtvtlahlallrgnrklallwllltlllgllFlvlqllEylhliaagftlsd..........
00407941   1/1  fnplglpllnTliLlsSsvtvtlahhallrgnrkllallwllltillGllFlalqlyEyle...agftls
00428451   1/1  ldllglpllnTliLlsSsvtvtlahhalllrgnrklallwllltillGllFlalqlyEyah...agftls
00417811   1/1  llpllnTliLlsSsvtvtlahhallkgnrklallwllltillGllFlvlqlyEylh...agftlsd....


                         +         -         -         -         -         *         -:210
query           PVELFFFLYFLMTGMHAVHVTIGILIMAAIAIMAGRRRFTSYYYTPVELTGLYWAFVDIVWIFLYPLFYL
00375591   1/1  ..svfgslfflltgfHglHVliGlifllvlllrlllgglsslhhlgleaaalYWHfvdvvWlflfllvYl
00407941   1/1  ds............vygstfflltgfHglHVliGlifllvlllrlllghftsthhfgleaaalYWHFVDv
00428451   1/1  d............svygstfflltgfHglHVliGlifllvlllrlllghftpthhfgleaaalYWHFVDv
00417811   1/1  ........svfgstFflltgfHglHVliGlifllvlllrlllggftsthhfgleaaalYWHFVDvVWlfl


                         -         -         -         +         -         -         -:280
query           VART------------------------------------------------------------------
00375591   1/1  lgr-------------------------------------------------------------------
00407941   1/1  VWl-------------------------------------------------------------------
00428451   1/1  VWl-------------------------------------------------------------------
00417811   1/1  fll-------------------------------------------------------------------