[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA57806.1


[Show Plain Result]

## Summary of Sequence Search
   1::212
   1::211  1.6e-70 44.5% 0050770 00507701 1/1   edoxin-like                             
   2::214  1.6e-63 40.6% 0050915 00509151 1/1   edoxin-like                             
   3::210  6.7e-56 38.6% 0048804 00488041 1/1   edoxin-like                             
   1::193  3.9e-52 42.1% 0048990 00489901 1/1   edoxin-like                             
   8::174  2.7e-51 42.1% 0052983 00529831 1/1   edoxin-like                             
   2::191    3e-49 36.9% 0050002 00500021 1/1   edoxin-like                             
   3::168  1.4e-47 36.2% 0051602 00516021 1/1   edoxin-like                             
   2::169  1.8e-44 32.7% 0049009 00490091 1/1   edoxin-like                             
   3::188  6.2e-44 38.7% 0048298 00482981 1/1   edoxin-like                             
   1::159  3.3e-42 41.8% 0052012 00520121 1/1   edoxin-like                             
   3::168  1.9e-41 36.0% 0050456 00504561 1/1   edoxin-like                             
   1::157    3e-39 41.1% 0049667 00496671 1/1   edoxin-like                             
   1::157  8.4e-38 38.8% 0047173 00471731 1/1   edoxin-like                             
   2::164  1.2e-37 35.0% 0046445 00464451 1/1   edoxin-like                             
   4::157  1.9e-37 35.1% 0050985 00509851 1/1   edoxin-like                             
   3::157  4.1e-37 37.8% 0048388 00483881 1/1   edoxin-like                             
   7::166  4.5e-36 34.0% 0051667 00516671 1/1   edoxin-like                             
   1::155  1.2e-33 31.5% 0048908 00489081 1/1   edoxin-like                             
   2::164  2.5e-33 32.3% 0052340 00523401 1/1   edoxin-like                             
   2::159  2.7e-33 35.4% 0051125 00511251 1/1   edoxin-like                             
   1::157  8.2e-33 32.0% 0048812 00488121 1/1   edoxin-like                             
   1::161    3e-32 33.6% 0051123 00511231 1/1   edoxin-like                             
   1::153  4.5e-32 35.7% 0043030 00430301 1/1   edoxin-like                             
   2::159  3.9e-30 33.8% 0051703 00517031 1/1   edoxin-like                             
   5::158    1e-27 27.4% 0043753 00437531 1/1   edoxin-like                             
   1::182  2.4e-27 28.4% 0052322 00523221 1/1   edoxin-like                             
   9::162  8.2e-25 28.1% 0052802 00528021 1/1   edoxin-like                             
   9::163  1.1e-24 27.6% 0052893 00528931 1/1   edoxin-like                             
   1::158  2.4e-24 29.5% 0041935 00419351 1/1   edoxin-like                             
   9::158  5.7e-19 26.4% 0051671 00516711 1/1   edoxin-like                             
   4::160  6.7e-19 29.9% 0051931 00519311 1/1   edoxin-like                             
   4::155  1.6e-18 24.4% 0047310 00473101 1/1   edoxin-like                             
   2::158  1.9e-17 23.6% 0039527 00395271 1/1   edoxin-like                             
   6::157  2.7e-15 26.3% 0048033 00480331 1/1   edoxin-like                             
   3::157  7.7e-15 27.6% 0051923 00519231 1/1   edoxin-like                             
  10::162  3.2e-14 21.6% 0051497 00514971 1/1   edoxin-like                             
   4::156  3.9e-13 21.7% 0042825 00428251 1/1   edoxin-like                             
   2::157  1.1e-11 23.4% 0041722 00417221 1/1   edoxin-like                             
   4::161  9.5e-08 25.2% 0049857 00498571 1/1   edoxin-like                             
   1::157  1.2e-07 22.2% 0040163 00401631 1/1   edoxin-like                             
   2::155  1.9e-07 23.0% 0051504 00515041 1/1   edoxin-like                             
   7::155  3.7e-07 17.7% 0052617 00526171 1/1   edoxin-like                             
  16::156  3.6e-05 16.3% 0038196 00381961 1/1   edoxin-like                             
   1::212


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MALHIGDVAPDFTQESTIGPLHFHDWIGNGWAVLYSHPADYTPVCTTELGTTAKLADEFKKRDVKVAALS
00507701   1/1  lmmmllvGdkaPdftlpttdgefktvslsdlkG.kwvvLffyPadfTpvCttelpafadlydefkklgve
00509151   1/1  -mllvgdkaPdftlpdtdgefltvslsdlkgkwvvLffyPadfTpvCttelpeladlyeefkklgvevlg
00488041   1/1  --llvGdpaPdftlpdldGkvslsdlkgdkvvvlffyPatfcpvCttelpalaeladefkakgvevvgvs
00489901   1/1  vgmmllvGdpaPdftlpavvdtdgktvslsdfkGk.vvvlffyPadftpvCttelpalaelaeefkklgv
00529831   1/1  -------kaPdftlpavlldtdgktvslsdlkggkkvvlffypadftpvCttelpafadlydefkkkgve
00500021   1/1  -GllkvgdpaPdftltdldgkgeflpvslsdlkGk.vvllffwPatwCpvCptelpalaelydefkdkgv
00516021   1/1  --llvgdkapdftlpdldgktlllldvslsdllkgkvvvlffwPatwcpvCttelpalaeladelkdkgv
00490091   1/1  -sgmllvgdpapdftltdldgkgelltvslsdlkG.kvvllffwPatwCpvCptelpalaelyeelkdkg
00482981   1/1  --slvgdkapdftlpalldtdgktvslsdlkGk.vvvlffwPatwcpvCttelpalaelydefkdkgvev
00520121   1/1  llllllllllvllagmlllvgdkapdftltdtdgktvslsdlkgk.wvvlffyPatftpvCttelpafae
00504561   1/1  --slvgdpapdftltdldgklellpvslsdlkG.kvvllffwPatwCpvCptelpalaelaeefkdkgve
00496671   1/1  lmsllvgdkaPdftllallpdtdgktvslsdlfkgkkvvlffyPaaftpvCttehlpaladladefkklg
00471731   1/1  msllvgdkaPdftlltdldgktvslsdllkgkvvvlffyPaafcpvCttehlpalaeladefkklgvevv
00464451   1/1  -Gallvgdkapdftltalledldgktvslsdlkgk.vvllffwPatwCpvCptelpalaelydelkdkgv
00509851   1/1  ---kvgdpaPdftlpalvldlgllldldgkplsledvslsdllkgkvvvlffyPatwcpvCttvelpala
00483881   1/1  --lkvgdkaPdftlpalldldgktvslsdllkgkvvvlffyPaaftpvCttehlpalaeladefkalgvl
00516671   1/1  ------dpapdftltdldgkglltvslsdlkG.kvvllffwPatwCpvCptelpalaelydelkdkgvev
00489081   1/1  tlllllllvslagalllvgdpapdftltdldgktvslsdlkG.kvvllffwpaswcpvCttelpalaela
00523401   1/1  -lllvgdpapdftltdldgktvslsdllkkgkvvllffwPatwCpvCttelpalaelaeelkdkgvevvg
00511251   1/1  -lllvgdpapdftltdldgkpvslsdlkgdkvvllffwPatwCpvCttelpalaelaeelkdkgvevlgv
00488121   1/1  llllllllvlllgalllvgdpapdftltdldgktvslsdlkGk.pvllffwatawcppCptelpalaela
00511231   1/1  alvlllglaldlvgalllvgdpapdftltdldGkpvslsdlkG.kvvllffwpaswcpvCttelpalael
00430301   1/1  malvtllglallllgellkvgdkaPdftlvdldgeevslsdfkgkkvvlffyPadftpvCtteapefnel
00517031   1/1  -slplllvgdkapdftlpdldgktvslsdllkgkvvvlnFiyPatwCpvCttelpalaelyeefkdk.ve
00437531   1/1  ----vgdpapdfeltdldgkevslsdlkgkpvlldfya.swCppCkteapeleelaeelkdkgvvvvgvs
00523221   1/1  llsplllvgdpapdftlpdldGktvslsdlkG.kvvlvvfwa.twCppCkaelpeleelaeeykd.gvvv
00528021   1/1  --------lPapdftlvdldgetvslsdlkg.kpvlvdfya.swCppCktelpaleelaeelkdkgvvvl
00528931   1/1  --------AP.ftltdldgktvslsdlkG.kvvllffwatwcppvCptelpalaelyeelkdrlladgve
00419351   1/1  aaaltllevgdpapdftltdqdGktvslsdlkG.kvvllyfyatwcppvCptelpeladlykklkdkgkd
00516711   1/1  --------slPalpdftlvdldgetvsladlkg.kpvlvdfya.swCppCkaeapeleelaeel..dgvv
00519311   1/1  ---eigklapdftltdqdGktvtlsdlkG.kvvllyfgftdCpdvCpteladlaelyeelkdllgddvqv
00473101   1/1  ---Aevgdpap.fslkdldgetlevslsdlkgkpvlvdfw.atwCppCkaeapeleelaeelkeddgvvv
00395271   1/1  -lllvgdpapdftltdldgkevslsdlkgkpvlvdfya.twCgpCkaeapeleelakelkdkgvvvvgvd
00480331   1/1  -----Gdpapdftlvdldgetfdladlkgkpvlvdfwa.twCppCkaeapvleelaeelk..gvvvvgvd
00519231   1/1  --llvgdpaPdftlpvldldgktfsladlkg.kpvlvnFw.atwCppCkaelpeleelaeeykd.gvvvv
00514971   1/1  ---------Pdftlkdldgetvsladlkgkpvlvdfwa.twCppCraelpaleelaee....gvvvvgvn
00428251   1/1  ---lvgkpapdfslvdl.dgeefdlavlkgkpvlvdFyaswCgpCkalapvleelaeelkgekgvvvvkv
00417221   1/1  -lllvgdpapvfeltdldgeevvlsdlkgkpvlvyFwa.swCppCkalapvleelaekykdekgvvvvkv
00498571   1/1  ---aegqpapdfvvlltldgfalaladlsgkpvlvdfwaswCgpCkalapeleelaeeyklldgvvvvkv
00401631   1/1  lllsllvgkpapdfslvdl.dgenfdlavlkgkpvlvdfwaswCgpCkalapvleelakey...gvvvvk
00515041   1/1  -lllllrlllllkslllllllllallvgdpapdftlpdldgkvvslsdnFde.lkgkpvlvFfgll.WCg
00526171   1/1  ------ksapdftlpdlldgepvslsdl..rGkvvLlvfwaswCgpcpkeypgleelyekygdkglvvlg
00381961   1/1  ---------------qsapdftltdlldgkpvslsdlkGkvvllvfvaswCglcrpeypeLeelyekykd


                         -         -         *         -         -         -         -:140
query           VDDVDSHKGWISDINETQGCQVNFPIIADADRKVSELYDMIHPGASETVTVRSVYFIDPNKKIRAVITYP
00507701   1/1  vigvSvDspfshkawaetikelgklglpfpllsDpdgevakaygvliekg.gllalRatflidpdGkiry
00509151   1/1  vSvdsvfshkawaekikefgglgglnfpllsDpdgevakaygvllekellgkglglavRatflidpdgkv
00488041   1/1  vddpfdhkaflkkygalfdealllglpfpllsDpdgevakaygvliekdglgfgyllalratflidpdGk
00489901   1/1  evlgvsvDspfshkaflkkivelfglgglnfpllsDpdgevakaygvli..elgglalratflidpdGki
00529831   1/1  vlgvsvdspfshkaflkkylklfglgglnfpllsDpdgevakaygvllek...glalratflidpdgkir
00500021   1/1  evvgvsvddpfdhpaflkeylkffglyglpfpllsDpdgelakaygvlv..gylglalpatflidpdGkv
00516021   1/1  evvgisvddpfdhkaflkkylklfglgglpfpllsDpdgelakaygvlvek...glglpatflidpdgki
00490091   1/1  vevvgvsvddpfdhpafleeylkffglnglpfpllsDpdgelakaygvl..ggylvlalpatflidpdGk
00482981   1/1  lgisvddpedhkaflkkyaklfgl..nfpllsDpdgevakaygvl..ggllgralpatflidpdGkiryr
00520121   1/1  lydefkdlgvevlgvSvDspfdhkaflkkylklfgl..nfpllsdpdgevakaygvliek...glalrat
00504561   1/1  vvgvsvddpedhkaflkkygalfgl..nfpllsDpdgelakaygvlv..gylglalpatflidpdGkvry
00496671   1/1  vdevlgvsvddpfvhkafl....eklglpnkfpllsDpdgevakaygvlveksglgllvrglratflid.
00471731   1/1  lgvsvddpevlkafaekl....glpnnfpllsDpdgevakaygvliekdllgleylglalratflid.dg
00464451   1/1  evlgvsvddpfdhpaflkeyleffglgglnfpllsdpdgelakaygvlv..gylvlglpttflidpdGki
00509851   1/1  eladeflkdkgvlevvgvsvdspevlkaflkklgll.....pfpllsDpdgelakaygvlveksglglgv
00483881   1/1  evvgvsvddpevlkafaekl......gldpfpllsDpdgevakaygvlieksglgllvlglpatflid.d
00516671   1/1  lgvsvddpfdhpaflkeylkffglgglnfpllsdpdgelakaygvl..ggylglalpatflidpdGkvvy
00489081   1/1  eelk..gvevvgvsvddpealkaflekfg......ldnfpllsdfpdgelakaygvlledggylvlhlpa
00523401   1/1  vsvddpealkaflek......fglpfpllsdpdgelakaygvllegllgylvlglpatflidpdGkvvyr
00511251   1/1  svddpevlkaflekfg......lpfpllsdivpdgelakaygvlvek..glvalpatflidpdGkvvyrf
00488121   1/1  eelk..gvevvgvsvddpealkaflkkfgll.....nfpllsdvpdgelakaygvl..ggylglalpatf
00511231   1/1  aeel...gvevvgvsvddpevlkaflekfglp.....nfpllsdpdgelakaygvlledggygvlhlpat
00430301   1/1  aeel.k.gvevlgvsvdspfshkafa....ekegl..nfpllsDplrngelakaygvlgepsllgg..la
00517031   1/1  vvgisvdspevlkaflkklg......lnfpllsDpdgelakaygvlg..gllglalpatfli.kdgkivy
00437531   1/1  vddspeslkaflkkyg......lpfplladengelakaygvl........giPtlflidkdGkvvaryvg
00523221   1/1  vgvsvndfgnqeddspeelaafaekygl..tfplllDedgevakaygv........rgtPttflidkdGk
00528021   1/1  gvsvdsfperdspeelkefleklgvlnfpllsdengelakaygvlg........iPtlflidkdGkvvar
00528931   1/1  vlgvsvdperdspealkaflekfg..lpfplltgksdvdgelakaygvllkkeglgllldylvdhlpatf
00419351   1/1  vevlgvsvdperdtpeelkaflkk......fgltfplligltgdladdldkalakaygvlyekkglgylv
00516711   1/1  vvgvsvd...dspelakkflgvfglp.tfpllsdpggevaraygvl........alpttflidpdgkv.a
00519311   1/1  lfvsvDperdtpevlkeyaekfgpd..fpgltgdpeeikelakaygvyyekvglgdvdgdylvdhspttf
00473101   1/1  vgvsvddspelakkfv......egyp.tfplllsdgdvvgelagaygv........lglpttflidkdlg
00395271   1/1  vdenspeelkaflkkfg......ltfplllgdvdgilagelakaygvr........giPtlflidkdGkv
00480331   1/1  vddnpealkkfleklgl......pfpllsdpdgalakaygvrg........iPttflidkdGkivarlvg
00519231   1/1  gvnvdllgeedspealkkflkelgl......dfpvlldedgelakaygvrg........tPttflidkdG
00514971   1/1  vddspeavkaflkel......glpfpvllldpdgelakaygv........rgiPttflidkdGkivarlv
00428251   1/1  dvdenrdtlkkflkklg......lpfpllldpdvikelakaygvr........giPtlflfdkdGkvvar
00417221   1/1  dvddnpeelkeflkklg......lpfpllldpdvlgelakaygvrg........iPtlvlidkdGkvvar
00498571   1/1  dvddrp.......................dengelakkygvr........giPtlvlfdkdGkivaalry
00401631   1/1  vdvddsaeevkeflkkyg......lpfpvllgdengelakkygvrg........iPtlflfdkdGkvvar
00515041   1/1  pCkalapvl.elaeelkd.gvvvvkvdvdenpelakkflek......gvlgfPtlldfkgglavaygvgg
00526171   1/1  vpcdqfggqepgsneeikeflkyvrpglkygvtfpllakidvnganahplykflkaalggllgdslllle
00381961   1/1  kglvvlgfpcnqfgsqepgsneeilefckvvkfllkygvtfplfekidvnGenahplykflkealpglld


                         +         -         -         -         -         *         -:210
query           PSTGRDFGEILRVIDSLQLTDNYSVATPVDWKDGDDCVIVPSLTDPEVLKEKFPKGYEEIKPYLRMTPQP
00507701   1/1  vfvgplpvgrnvdevlralkalqltdkhgvvcPanwkpgedtlkpvivlpgvsleeakkrlpkglltvld
00509151   1/1  rlilvndvsvgrnvdeilrlldalqltdkhgvvcPanwkpgddvivpplvsveealk.lfpeglelldll
00488041   1/1  iryifvgplpvgrnvdellralkalqltdkpgvgcpanWkpgdevivppslsleealk.llgelllllll
00489901   1/1  ryvfvgdlpvgrnvdellrllkalqltdkhgvvcpanwkpGddvlvpsllsve-----------------
00529831   1/1  yvlvgplpvgrnvdellrllkalqlvdkhgvvtP------------------------------------
00500021   1/1  ryrfvgplspgrlvdeilrllkalqltdkpgvvcpanwkpgddvlvpslll-------------------
00516021   1/1  ryrlvgplpvgrlvdellrllkalqlvd------------------------------------------
00490091   1/1  vryrfvgelsperlvdeilrllkalqlvd-----------------------------------------
00482981   1/1  fvgplpvgrlvdellrllkalqlvdklpsvvcpakWkpgdevlvpsll----------------------
00520121   1/1  flidpdgkiravfvgvlpv---------------------------------------------------
00504561   1/1  rfvgelsperlvdeilrllkalqlvdkl------------------------------------------
00496671   1/1  dgkiryvfvgp.dvgrn-----------------------------------------------------
00471731   1/1  kiryvlvgplpvgrnvd-----------------------------------------------------
00464451   1/1  vyrfvgpldperlvdeilrllkal----------------------------------------------
00509851   1/1  rglpatflid.dGkiry-----------------------------------------------------
00483881   1/1  gkiryvfvgplptgrpl-----------------------------------------------------
00516671   1/1  rfvgelsperladeilrllkalqavd--------------------------------------------
00489081   1/1  tflidpdGkvvyrfl-------------------------------------------------------
00523401   1/1  fvgplspveplaeellr..lalkl----------------------------------------------
00511251   1/1  vgelnpldlerdieellra---------------------------------------------------
00488121   1/1  lidpdGkvvyrgfvgdl-----------------------------------------------------
00511231   1/1  flidpdGkvvylrfvgdldpe-------------------------------------------------
00430301   1/1  lRatflidkdgkv---------------------------------------------------------
00517031   1/1  vfvglldplslerlveell---------------------------------------------------
00437531   1/1  ....ardadellellekl----------------------------------------------------
00523221   1/1  vvyrgvgdlsrkvlgevdaeellaaleallaggpvpltqtps----------------------------
00528021   1/1  fvgaldpe.dleelle....lq------------------------------------------------
00528931   1/1  lidpdGkvvarfvgeldperlad-----------------------------------------------
00419351   1/1  dhipttflidpdGkivar----------------------------------------------------
00516711   1/1  ryvg....gldpdellel----------------------------------------------------
00519311   1/1  lidpdGrivavyvgdlsper--------------------------------------------------
00473101   1/1  kivarfvgelspedl-------------------------------------------------------
00395271   1/1  varyvgaldaer..dell----------------------------------------------------
00480331   1/1  akv..rdaeelleflek-----------------------------------------------------
00519231   1/1  kivarlvGal....dae-----------------------------------------------------
00514971   1/1  galdaeeleelleklleellle------------------------------------------------
00428251   1/1  yvgartlaeelvefie------------------------------------------------------
00417221   1/1  yvg....ardaeeleef-----------------------------------------------------
00498571   1/1  vGa..ldaeelleflkk..lk-------------------------------------------------
00401631   1/1  yvGa....ldaeeleef-----------------------------------------------------
00515041   1/1  ........lpatfli-------------------------------------------------------
00526171   1/1  llkllllklakaygi-------------------------------------------------------
00381961   1/1  edgklakafgvlvlkp------------------------------------------------------


                         -         -         -         +         -         -         -:280
query           NK--------------------------------------------------------------------
00507701   1/1  v---------------------------------------------------------------------
00509151   1/1  lllk------------------------------------------------------------------
00488041   1/1  ----------------------------------------------------------------------
00489901   1/1  ----------------------------------------------------------------------
00529831   1/1  ----------------------------------------------------------------------
00500021   1/1  ----------------------------------------------------------------------
00516021   1/1  ----------------------------------------------------------------------
00490091   1/1  ----------------------------------------------------------------------
00482981   1/1  ----------------------------------------------------------------------
00520121   1/1  ----------------------------------------------------------------------
00504561   1/1  ----------------------------------------------------------------------
00496671   1/1  ----------------------------------------------------------------------
00471731   1/1  ----------------------------------------------------------------------
00464451   1/1  ----------------------------------------------------------------------
00509851   1/1  ----------------------------------------------------------------------
00483881   1/1  ----------------------------------------------------------------------
00516671   1/1  ----------------------------------------------------------------------
00489081   1/1  ----------------------------------------------------------------------
00523401   1/1  ----------------------------------------------------------------------
00511251   1/1  ----------------------------------------------------------------------
00488121   1/1  ----------------------------------------------------------------------
00511231   1/1  ----------------------------------------------------------------------
00430301   1/1  ----------------------------------------------------------------------
00517031   1/1  ----------------------------------------------------------------------
00437531   1/1  ----------------------------------------------------------------------
00523221   1/1  ----------------------------------------------------------------------
00528021   1/1  ----------------------------------------------------------------------
00528931   1/1  ----------------------------------------------------------------------
00419351   1/1  ----------------------------------------------------------------------
00516711   1/1  ----------------------------------------------------------------------
00519311   1/1  ----------------------------------------------------------------------
00473101   1/1  ----------------------------------------------------------------------
00395271   1/1  ----------------------------------------------------------------------
00480331   1/1  ----------------------------------------------------------------------
00519231   1/1  ----------------------------------------------------------------------
00514971   1/1  ----------------------------------------------------------------------
00428251   1/1  ----------------------------------------------------------------------
00417221   1/1  ----------------------------------------------------------------------
00498571   1/1  ----------------------------------------------------------------------
00401631   1/1  ----------------------------------------------------------------------
00515041   1/1  ----------------------------------------------------------------------
00526171   1/1  ----------------------------------------------------------------------
00381961   1/1  ----------------------------------------------------------------------