[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA57977.1


[Show Plain Result]

## Summary of Sequence Search
   1::366
   7::349 4.9e-145 57.7% 0046975 00469751 1/1   ase                                     
   8::353 2.4e-129 53.5% 0047183 00471831 1/1   ase                                     
  36::348  1.5e-72 41.3% 0046288 00462881 1/1   ase                                     
  52::336  1.8e-70 44.4% 0046878 00468781 1/1   ase                                     
   5::357    2e-65 31.6% 0049279 00492791 1/1   ase                                     
  37::356  4.6e-44 24.5% 0048496 00484961 1/1   ase                                     
  36::355  3.5e-20 22.7% 0051114 00511141 1/1   ase                                     
   1::366


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MSFPTEDLRIKNIQEVIPPAQLHEGLPITSEASKTVYRTRQAIQEVLGGKDDRLLVVAGPCSIHDPQAAR
00469751   1/1  ------dlrilgikplispaelleelPlseellelvlesreeildillgeddrllviaGPCsiedeeaal
00471831   1/1  -------lrilsleplpspeelleelplsealaelvlesrveivdillggddrllviaGPCsiedeeaal
00462881   1/1  -----------------------------------vlnsrikignilignddrllviaGpcsieseeaal
00468781   1/1  ---------------------------------------------------drllviaGpCsieseeaal
00492791   1/1  ----miivlklgaaeeeleevlelieelglkvllivglerlligllgdlsvllieplislagveevlpls
00484961   1/1  ------------------------------------edtvvkigdiliggdkpllliaGpcvieseelal
00511141   1/1  -----------------------------------lvlelikivsrligeddpllvIaeigvnhngdlel


                         -         -         *         -         -         -         -:140
query           DYGKRLKLLIDELADELLIVMRVYFEKPRSTVGWKGLINDPHLDGSFQINEGLRLARRLLLDLAETGVPA
00469751   1/1  eyaerLkelaeklkdgllivmrvyfeKPrttvgwkGlindPdldgsfdieeGLkilrkllldlaelglpv
00471831   1/1  eyAerLkelgaklkddllivlRvyfeKPrttvgfkGlindPdldgsfdieeGLkilrkllldleelglpv
00462881   1/1  eyAkrlielakkl..gldivfkvsfekpnrtsvdsfkgl..............gleeglklllevaeelg
00468781   1/1  eyaerlkelgaklldillivlrsyakkpRtsvgsfkGlgleegldilaevkeel.............glp
00492791   1/1  epyklvsrearpeitviliggvligddrplviaGpcsieslelalelaealkea.......gadavrfgt
00484961   1/1  eiAealkelaeel..giplvrkgsfkkapRTspysfrglg.........leeglkilaev...keelglp
00511141   1/1  akeliliAgpcgaesvkfqlltaetlvkklgili.lkgsadkprtslysflglgleglkiLaevaeelgl


                         +         -         -         -         -         *         -:210
query           GTEYLDLVSPQYIADLIAWGAIGARTTESQVHRELASGLSCPVGFKNATNGSLGAAMSAIVSASKPHHFL
00469751   1/1  atevldpitpqyvadlvdwlaiGArttesqlllelasglskPvglKngtdgnlevalnailaasaphlfl
00471831   1/1  atEvldpispqyvadlvdwlaIGArttesqlllelasglskPvglKngtdgtlevaldAilaasaphffl
00462881   1/1  lpvltevldpisvdlladlvdvlqIgArltentdllrevAs.tgkpvllkngtsasleealnavek....
00468781   1/1  vatevldpiqvelvadlvdvlqigArltentdlleaaagtgkpvllKkGtfltleealnave........
00492791   1/1  fkprtsvysfqglgle...........glkilrell...eelglpvltevldpesvdlladlvdilqigA
00484961   1/1  vvtevhdpeqvelvaevvdvlqigArlmrntdlleavaktgkpvllkkgqfltleemlnaae........
00511141   1/1  pvltevfdlesvdllaelgvdvlkigafeltntdllravak.tgkpvilktGmatleeillavekl....


                         -         -         -         +         -         -         -:280
query           SLTLAGRSAIFSTAGNPDCHLILRGGQKPNYDAASVNETAHNLIQTGLRPQVMIDCSHGNSSKNPKKQVL
00469751   1/1  gvnkeGlaaivlttGnpdvhlilRGgsfpnydlvslalalvllakaglnlpvvvDasHsnsgkdlerqll
00471831   1/1  gvdkegvaeivltsGnpdvhlilRGgrtgpnylvldlaavplllekagl.P.vivDasHangnkdlvrql
00462881   1/1  ..............iltaGnpdiillergssypynylvvdl.raipilkklflglpvivDasHsnslkgg
00468781   1/1  ..........kiltaGnpnvilieRGgstgpnylvldlralpvlle..glp..vivDashsvslkgglgq
00492791   1/1  rnmtnfdlleaaaktgkpvllkrGmsatleeilnAv..................eyilsagnpnviller
00484961   1/1  ..........kilsaGndnvilcerGistgynrlvldlralpvlkelltglPvivDpsHavqlpgglgds
00511141   1/1  .................reagnd..lvllrctrgyptpyenldlraipvlkel.flpvivglSdHslglp


                         -         *         -         -         -         -         +:350
query           VARDIAGQIAAGDRRIMGVMLESHLVAGRQDVIPNTPLTYGQSITDACIGWEESEQLLREFARAIQKRRQ
00469751   1/1  vaedvleqraagavgidGvmiEshldpgnqlsdgpnsltygvsiTDaclgwedteklLrllaeavklrr-
00471831   1/1  avledvleqraagaagidGlmiEshlsdGnqslplddleellyglsitdaclgwedtekllrelaeavka
00462881   1/1  lsdhtlgvrelvlalaraavalgadGlmiEsHldpdnalsdgpqsltlg.sltdllidlkatekllgs--
00468781   1/1  lsvgrrvlvlalaraavalgadGlmiEsHldpdnalsDgpqslpldeleellygls--------------
00492791   1/1  GirtfypytrnvvdlraipllkelfglpvivDpsHglsdhelvlqlavaavalg........adGlmiEv
00484961   1/1  sgGlrelvlplaraavaaG...adGlfiEvhp...........dPdkalsdgpqalpldeleelleelra
00511141   1/1  .........laraA.valG.....alfiEkHftpdkalsgpDgpaslepd......elealveelraiek


                         -         -         -         -         *         -         -:420
query           MPEKHIEAKHGCSATP------------------------------------------------------
00469751   1/1  ----------------------------------------------------------------------
00471831   1/1  rle-------------------------------------------------------------------
00462881   1/1  ----------------------------------------------------------------------
00468781   1/1  ----------------------------------------------------------------------
00492791   1/1  Hlt....---------------------------------------------------------------
00484961   1/1  idelvk----------------------------------------------------------------
00511141   1/1  algdp-----------------------------------------------------------------