[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58119.1


[Show Plain Result]

## Summary of Sequence Search
   1::258
   3::168  2.5e-49 39.2% 0043743 00437431 1/1   ric LpxA-like enzymes                   
   1::169  2.4e-48 39.6% 0043848 00438481 1/1   ric LpxA-like enzymes                   
  12::168  1.7e-43 38.2% 0049600 00496001 1/1   ric LpxA-like enzymes                   
  12::169  3.2e-40 29.1% 0047822 00478221 1/1   ric LpxA-like enzymes                   
  18::217  2.8e-39 27.0% 0050899 00508991 1/1   ric LpxA-like enzymes                   
  12::185  6.5e-39 31.0% 0047866 00478661 1/1   ric LpxA-like enzymes                   
  14::171  5.6e-34 31.6% 0048541 00485411 1/1   ric LpxA-like enzymes                   
  60::237  6.4e-34 30.9% 0039338 00393381 1/1   ric LpxA-like enzymes                   
  27::169  3.4e-30 32.9% 0047206 00472061 1/1   ric LpxA-like enzymes                   
  35::226    2e-27 28.8% 0044607 00446071 1/1   ric LpxA-like enzymes                   
  33::197  2.1e-26 25.9% 0050963 00509631 1/1   ric LpxA-like enzymes                   
  65::213  1.5e-25 36.9% 0049025 00490251 1/1   ric LpxA-like enzymes                   
  39::177  3.4e-25 30.4% 0052621 00526211 1/1   ric LpxA-like enzymes                   
  52::175  8.1e-25 33.9% 0047244 00472441 1/1   ric LpxA-like enzymes                   
  61::170  1.7e-23 37.3% 0053166 00531661 1/1   ric LpxA-like enzymes                   
  58::179  1.3e-12 27.3% 0051363 00513631 1/1   ric LpxA-like enzymes                   
   1::258


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MFKRLQEEIKCVFERDPAARNAFEVITTYPGFHAIVWHRLSHRLWNLGAKWLARAISTLSRWLTGIEIHP
00437431   1/1  --lldpllalalllallllelelllgillsagildrallaealailllaviedlavigvtvvigagvvig
00438481   1/1  avigpgavigvnvvigpgvvigdgvvigdgtvalilpnvvllgatriglgvvilsgavigdalfglaydl
00496001   1/1  -----------vldldpaagllklaillyfglpalafarvavllgndklilklayilpsagigtgvrigp
00478221   1/1  -----------liggdpviignvtillsvvigngvtiiggaviiylgaliglapgigpyirilpgvvigd
00508991   1/1  -----------------cvigplvvigdgtvlhalvvirggtrigllnlillgagigvlvqilpyadigg
00478661   1/1  -----------lpellellaqgelyltddigllalllralllllllnlliglatlihptavilggveige
00485411   1/1  -------------lklleyllqgewylvgtpelalealrlllllllllllglallihptalillgakige
00393381   1/1  -----------------------------------------------------------lrihptavidp
00472061   1/1  --------------------------ltllipptavidggvvigedvvigpnvviggnvvigdnvvigpn
00446071   1/1  ----------------------------------ipptalidlgakigegvvigpgavi...ggnvvigd
00509631   1/1  --------------------------------llihptaligpgavigegvviapnavi...ggnvvigd
00490251   1/1  ----------------------------------------------------------------gvvihl
00526211   1/1  --------------------------------------rildgavigellgllpligellliapnaviye
00472441   1/1  ---------------------------------------------------lalligptavidegvvigk
00531661   1/1  ------------------------------------------------------------gllggviIgd
00513631   1/1  ---------------------------------------------------------tsarilppaviig


                         -         -         *         -         -         -         -:140
query           GAQIGQRFFIDHGMGVVIGETAEIGNDCTLYHGVTLGGTSWQKGKRHPTLGNNVVVGAGAKVLGPIHIGS
00437431   1/1  kdveigedvvidpnvviigdvaigdgvvillgaviggalqryrlahlllkkagvgpavrigdgveigani
00438481   1/1  lgslleilvllladllavrlrdpaarsllevllllkgllalllyrlahllggkvrigpavvigpgvvigg
00496001   1/1  gavigkgavigegtvimpavinagayigentiintgavighdavIGdnvhigpgvtiggdlfglqagpvi
00478221   1/1  nveIGenvtidrgtviviggnvtigdnvnighgvvignhdhplviaggvviaggvtIgdnvwIGagavil
00508991   1/1  gviIGdnvsigagvtivdgggttiGdnvligpgvtighdvhigdnviigvvlaghvtIgddvwIGagati
00478661   1/1  gvvIgpgvvidhggnvvIGdnvvigpnvvildggdvvIGdnvligpgvvigtdnhglgtitrnydgvlkg
00485411   1/1  gvvigpgavigyggnvvigdnvvigpgvvildvggvvIgdnvligpgvtighdshigdnvtigngveiag
00393381   1/1  gavigegvvigpgaviggnvvigdgvvigpgvviggdivIGdnvvigdgaviggdgfglpkaglrggviI
00472061   1/1  vvirgtvigdnvrilsglvigagifgaayigpfarllggvvIgdnvsigagvtidrgtlggtvigdnvli
00446071   1/1  gavigpgvvirgdvglvvIGdnvvigdgvtihlhvghdsvigdgvtigngvviggviIgdnvwigagavi
00509631   1/1  gvvigpgvvirgdvglvvIgdnvvigdgvtihtgthkdtvigdgvkighlvvigdvvIgdnvwigagavi
00490251   1/1  rgaligdgtvigdgvidngvvig.dviIGdnvtigpgvtlg........gpvtIgdnvwiGagavilp.v
00526211   1/1  nvvigdnvvigsgavilelallgadgfgfalikipqlgnviigdnveiganttidrgtlldagvklnhlt
00472441   1/1  dvvigpnvviggnvligdnvvigpnvviggtiigdnvriksgaviggvgiglavrigpfarirggvvigd
00531661   1/1  nvtIgegvtihggthpldgvtvigdgvkidhlvhighdvvigdgviiangvglag........hvtigdn
00513631   1/1  dvligegvvigpgavinvvigdnvvigdgavieddvvigdnvligpgaviggnvvigdnvtIganaviln


                         +         -         -         -         -         *         -:210
query           GVRIGSNSVVVKSVPANTTVIGVPGRMVQSKDQRREAKHQAMAKRIGFDAYGTPQDTPDPIERAIHGLIE
00437431   1/1  tIgpgarIgdgvkidhgtgvvighdavi------------------------------------------
00438481   1/1  gvvigpgaeigegvvidhltgvvIghdav-----------------------------------------
00496001   1/1  IgdnvlIGagatilggvvIgegavigag------------------------------------------
00478221   1/1  pgvtIGdgavigagsvVtkdvppgslvaG-----------------------------------------
00508991   1/1  lpgvtIGdgavigagsvVtkdvppysvvaGnPakvirlrfeglkrllllelaiwdlraaylllflsllll
00478661   1/1  pvvIgdnvwiGanatilpgvtIgdgavigagsvVtkdvppgslvv-------------------------
00485411   1/1  pvvigdnvwigagavilpgvtIgdgavigag---------------------------------------
00393381   1/1  gdnvtIgenvtihrgthpldgvtrigdgvkidhlvyighdcvigdnviigagvvlaggvtigddvwiGag
00472061   1/1  gdnvhighdvtigdgviiangvgviaggv-----------------------------------------
00446071   1/1  lggvtigdgavigagsvVtggkdvppgslvvGnPakvi..........................rglsde
00509631   1/1  lggvtigdgavigagsvVtkdtvvppgslvvGnPakvirelseeelallllalkllv-------------
00490251   1/1  tIgdgavigagsvvtevt.vppgsslvvGnvarrlfdeelialllkalkl........llllealkllel
00526211   1/1  vigdgakidnlvqighnvvigdntiian.gsvtigdn---------------------------------
00472441   1/1  nvvigagvtidrgtiggtvigdnvsiggnvvighn-----------------------------------
00531661   1/1  vwiGgnavilpgvtIgdgavigagsvVtkd----------------------------------------
00513631   1/1  aiigkgvlIgdnvvigagavvlnddtvigdnvi.vggga-------------------------------


                         -         -         -         +         -         -         -:280
query           HIQRLDERIEQMTAEIKNLGGDLPGEHLPSLDEEQARQVAEDKSAIAK----------------------
00437431   1/1  ----------------------------------------------------------------------
00438481   1/1  ----------------------------------------------------------------------
00496001   1/1  ----------------------------------------------------------------------
00478221   1/1  ----------------------------------------------------------------------
00508991   1/1  edilell---------------------------------------------------------------
00478661   1/1  ----------------------------------------------------------------------
00485411   1/1  ----------------------------------------------------------------------
00393381   1/1  avilpgvtIgdgavigagsvVtkdvpp-------------------------------------------
00472061   1/1  ----------------------------------------------------------------------
00446071   1/1  eiallrkaakllvrll------------------------------------------------------
00509631   1/1  ----------------------------------------------------------------------
00490251   1/1  lle-------------------------------------------------------------------
00526211   1/1  ----------------------------------------------------------------------
00472441   1/1  ----------------------------------------------------------------------
00531661   1/1  ----------------------------------------------------------------------
00513631   1/1  ----------------------------------------------------------------------