[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58132.1


[Show Plain Result]

## Summary of Sequence Search
   1::206
   1::202  8.7e-53 42.1% 0046442 00464421 1/1   p containing nucleoside triphosphate hy 
   1::202  1.4e-39 32.8% 0048706 00487061 1/1   p containing nucleoside triphosphate hy 
   1::197  3.2e-31 35.6% 0046916 00469161 1/1   p containing nucleoside triphosphate hy 
   2::195  9.7e-31 32.2% 0046441 00464411 1/1   p containing nucleoside triphosphate hy 
   1::204  2.6e-30 31.0% 0053350 00533501 1/1   p containing nucleoside triphosphate hy 
   1::189  3.9e-27 30.6% 0042008 00420081 1/1   p containing nucleoside triphosphate hy 
   1::196  2.1e-24 26.9% 0053247 00532471 1/1   p containing nucleoside triphosphate hy 
   2::202  6.5e-24 32.0% 0049657 00496571 1/1   p containing nucleoside triphosphate hy 
   1::203  4.3e-23 29.3% 0048702 00487021 1/1   p containing nucleoside triphosphate hy 
   1::196  5.3e-22 31.8% 0048692 00486921 1/1   p containing nucleoside triphosphate hy 
   1::196  5.7e-22 33.7% 0049306 00493061 1/1   p containing nucleoside triphosphate hy 
   1::197  1.2e-21 27.3% 0047813 00478131 1/1   p containing nucleoside triphosphate hy 
   1::204  3.4e-21 30.1% 0051580 00515801 1/1   p containing nucleoside triphosphate hy 
   1::197  3.9e-21 25.3% 0047808 00478081 1/1   p containing nucleoside triphosphate hy 
   1::200  2.3e-20 32.1% 0051535 00515351 1/1   p containing nucleoside triphosphate hy 
   1::200  3.5e-20 28.1% 0053315 00533151 1/1   p containing nucleoside triphosphate hy 
   1::197  3.9e-20 31.6% 0046459 00464591 1/1   p containing nucleoside triphosphate hy 
   1::197  1.6e-19 32.2% 0049606 00496061 1/1   p containing nucleoside triphosphate hy 
   1::196  3.1e-19 34.5% 0048689 00486891 1/1   p containing nucleoside triphosphate hy 
   1::197  3.2e-19 29.4% 0051851 00518511 1/1   p containing nucleoside triphosphate hy 
   1::197  4.6e-19 34.9% 0045785 00457851 1/1   p containing nucleoside triphosphate hy 
   1::186  1.6e-18 23.3% 0047538 00475381 1/1   p containing nucleoside triphosphate hy 
   1::199  2.2e-18 28.9% 0045788 00457881 1/1   p containing nucleoside triphosphate hy 
   1::198  1.2e-16 29.0% 0049881 00498811 1/1   p containing nucleoside triphosphate hy 
   1::198  1.7e-16 25.3% 0047839 00478391 1/1   p containing nucleoside triphosphate hy 
   1::199  2.2e-16 30.5% 0048939 00489391 1/1   p containing nucleoside triphosphate hy 
   1::197    4e-16 31.4% 0049933 00499331 1/1   p containing nucleoside triphosphate hy 
   1::180    3e-15 22.6% 0043440 00434401 1/1   p containing nucleoside triphosphate hy 
   1::201  3.1e-15 25.0% 0051206 00512061 1/1   p containing nucleoside triphosphate hy 
   1::201  3.6e-15 31.1% 0048272 00482721 1/1   p containing nucleoside triphosphate hy 
   1::202  5.3e-15 27.6% 0049919 00499191 1/1   p containing nucleoside triphosphate hy 
   1::198    6e-15 31.5% 0049317 00493171 1/1   p containing nucleoside triphosphate hy 
   1::204  9.7e-15 26.6% 0048963 00489631 1/1   p containing nucleoside triphosphate hy 
   1::197  3.4e-14 25.3% 0050194 00501941 1/1   p containing nucleoside triphosphate hy 
   1::202  3.8e-14 24.0% 0046276 00462761 1/1   p containing nucleoside triphosphate hy 
   1::202    4e-14 22.6% 0047291 00472911 1/1   p containing nucleoside triphosphate hy 
   1::196  1.3e-13 27.3% 0047933 00479331 1/1   p containing nucleoside triphosphate hy 
   1::197  1.9e-13 25.9% 0047772 00477721 1/1   p containing nucleoside triphosphate hy 
   1::204    2e-13 27.0% 0049398 00493981 1/1   p containing nucleoside triphosphate hy 
   1::208  2.2e-13 28.8% 0051604 00516041 1/1   p containing nucleoside triphosphate hy 
   2::207  8.4e-13 26.2% 0047607 00476071 1/1   p containing nucleoside triphosphate hy 
   1::203  9.2e-13 27.5% 0048044 00480441 1/1   p containing nucleoside triphosphate hy 
   2::202  3.3e-12 25.0% 0049343 00493431 1/1   p containing nucleoside triphosphate hy 
   1::200  9.2e-12 25.0% 0049190 00491901 1/1   p containing nucleoside triphosphate hy 
   1::198  3.8e-10 24.7% 0050867 00508671 1/1   p containing nucleoside triphosphate hy 
   1::196  4.7e-08 24.7% 0045157 00451571 1/1   p containing nucleoside triphosphate hy 
   1::180  1.3e-07 22.6% 0045970 00459701 1/1   p containing nucleoside triphosphate hy 
   1::144  1.7e-07 29.9% 0048050 00480501 1/1   p containing nucleoside triphosphate hy 
   1::199  8.7e-07 20.9% 0046162 00461621 1/1   p containing nucleoside triphosphate hy 
   1::205  1.3e-06 15.4% 0047756 00477561 1/1   p containing nucleoside triphosphate hy 
   1::155  4.8e-05 23.3% 0038144 00381441 1/1   p containing nucleoside triphosphate hy 
   1::206


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MLEGIEGAGKSTQLKFIQQLLQSTEKNVIVTREPGGTFLGEQIRELLLSPRLEGMSADTELLLMFAARVE
00464421   1/1  MkkgkfIvieGpdGsGKTTlaklLae.l.elgigvvvtrEPvdywrevggtpllelirelllaldfgeil
00487061   1/1  ldMkkgklIvieGppGsGKtTlakaLaer.gargldvvviyepvdywaavgggdllrlirelllrlgfge
00469161   1/1  llIvieGppGsGKsTlaklLaerlgltglsvlltredgfgtplgelirelllegfqdlilvpdllvlell
00464411   1/1  -llGpsGsGKsTlaklLagllgptggsvlltgepvsgeplgeligevfqdg..ilfpdltvlenvalgry
00533501   1/1  rgeiialtGpsGsGKsTlaklLaellphldtgdvlldgepigtplgrgigyvfqdpalfpglt.vrenle
00420081   1/1  smkkglrIaleGpsGvGKTTlaklLarhlgptggrvllvgEPiaywrsvggsdlleliyqlplrldlgei
00532471   1/1  pGkiIvitGpsGsGKsTlarlLaellnglggivsvddlgrdvgelggaalldivde.grliglvfqdldl
00496571   1/1  -llGpsGsGKsTlarlLagll...ggsvldtgepirgeplgelirglvfq.dpllldeltvlenlalgry
00487021   1/1  rmkiivltGpsGsGKsTlarlLaell...gvvvidtddllragevfqdyalfphltvlelldnvllglei
00486921   1/1  mlivltGppGsGKtTlakaLaerlglpfistddllreavpggtdlgelfqelllegellfrdell.....
00493061   1/1  mlIvltGppGsGKtTlakaLaerlglpvistddllreavpggtelgeyirdlfdeggl..........ll
00478131   1/1  vltGppGsGKtTlarlLaellkplglgvvvi..dgddlrreavgqlglglsieelde...alllpdalrr
00515801   1/1  llIvltGppGsGKtTlaklLaerlglpfistddllreavpggtplgeeirdlldagellpdeelr.....
00478081   1/1  gkvivltGppGsGKtTlarlLaellkplgggvvvi..dtddlrreairelllgldlleilf...egllls
00515351   1/1  mngklivltGppGsGKtTlaraLaerl...glpvistddllreavpggtdigelfqdyllfpfltvdeni
00533151   1/1  MsldikkgklivltGppGsGKtTlarlLaerl...glpfistddllrelvpggldigevfqdaleagl..
00464591   1/1  klivltGppGsGKtTlakaLaerlglpfistddllreavlggtplgeeirdllea..........gallp
00496061   1/1  gklivltGppGsGKtTlaklLaerl...glpvistddllreevepggtdlgeifqalllagellfddevl
00486891   1/1  mlivltGppGsGKtTlakaLaerl...glpvidtddllreleidgtplgeeirdlllage..........
00518511   1/1  klIvleGpsGsGKsTlaklLaekl...glpfidtddl.............................liaa
00457851   1/1  PkgklivltGppGsGKtTlakaLaerl.....glpvistddllreavpggtrlgeviqdlfllgg.....
00475381   1/1  mkgeiialtGpsGsGKsTlarlLagllk....ptsgivsvdglrlavlsrdllgllreglirigyvfqdy
00457881   1/1  vltGppGsGKtTlaklLaerlglpvidtddllrelepdgtelgellqdlllag..........gllpdai
00498811   1/1  kPgkiigltGpsGsGKsTlarlLae.l...gvividgddltrelvaggglliglifqdfglfelldrell
00478391   1/1  lltGppGsGKtTlaralaerl...glpvidgddllrelvgeggrlgrd...........lfdedrllfre
00489391   1/1  lsikkgklivltGppGsGKtTlakaLaerlglpvistddllreavpggtdlgelfqdlllegellfidei
00499331   1/1  PslslkkgklivltGppGsGKtTlakaLaerlglpfidtddllrepvigagtdigevfqdlll...aggl
00434401   1/1  MlsksyggllalddvslsvkkgliigitGpsGsGKTTlaraLaellrerggsvavidlddfyrpaaell.
00512061   1/1  kkkkgklivltGppGsGKtTlakaLaerl.g.glvvidtddllrea...............gkirelfgf
00482721   1/1  gltGpsGsGKsTlarlLae.lglpvidtddlyrelvaggtplgerirellgegyllpdea.....lfral
00499191   1/1  kgkiigitGpsGsGKsTlaklLaellgatvgdvd.gllvgvvfqddfylllpalevlengaflldlllpd
00493171   1/1  mgklivllGpsGaGKsTlaklLaeklglivlsvgdttrepregevdgvdyvfvsgelfkeli........
00489631   1/1  MkgklillvGppGsGKtTlaraLaell...glpf..iridgddllrellgel.lgrgigfgfqqgdlled
00501941   1/1  lltGppGsGKttlaralaeel...glpfidaddllrelvgesirelfeaa.............grlapre
00462761   1/1  yygdvtaldgvsltikkgevialvGpsGsGKsTlaraLagllpeepgsgvvlldgddlr...lglliglv
00472911   1/1  mkmkkgklilltGppGsGKtTlaraLaellgapfisgddllrglageggkpl...............gll
00479331   1/1  apkliltGppGsGKttlakaLaeel...glpfidtddllrklvgesirellelagela............
00477721   1/1  kpklilltGppGsGKttlaraLaeel...glpfidtddllrelvgegielilelfd.............r
00493981   1/1  kpklilltGppGsGKttlaraLaeelglpfidaddllrelvg....................egigllfe
00516041   1/1  mlkgklillvGppGsGKtTlaralaeel...glpfvvidaddl...............lrgeelgriiel
00476071   1/1  -ltGpsGsGKsTlaklLae.lglpvidtddltregvllggpllerirel...lgegyllfdealdrella
00480441   1/1  rlivllGpsGaGKsTlaklLaellpglivisvgdttrepregevlg..vdyvfvdrelfeelivagnlle
00493431   1/1  -kGelivllGpsGaGKsTllkllagllgptsgvisvggttreprpgev.rgigyvfqsgalfphlivagn
00491901   1/1  lmkgkiilltGppGsGKttlakaLaeelglpfidtddllreaklggelaeliedlfv.............
00508671   1/1  hvsllklgeldislsikkgevivlvGpsGsGKsTlaraLakrLeepgsgvvlld..gddlraglsiglil
00451571   1/1  MsikkgeiiaivGppGsGKsTlaklLakll.......glivldgddllreaiglvtqdgelllelidegi
00459701   1/1  llvGppGsGKTTlakaLakrlgekgvkvv..vidtddlrreaikqliglg..lfdedgegalrrreavak
00480501   1/1  MgklillvGppGsGKtTlaralaell...g.gvvvid..gddlrralvggl.......idgllilflede
00461621   1/1  mkgmiialtGppGsGKsTlaklLaerlglpfistddlyrevvergtelgklikdyfdpgalvpdllirll
00477561   1/1  kkpkvillvGppGsGKtTlaraLakrlaelgkgvvvidtddlrr...alifqdeldlfdedree.gfrvp
00381441   1/1  GeliaivGpsGsGKsTLlklLagllppdsgsigslttrlprlgevdgvdltflsreeigyvfqepallpd


                         -         -         *         -         -         -         -:140
query           HVQQVIFPALAAGKWVLCDRFTSASYAYQGGGRELPLSRIAKLESWALNCLRPDLILLFDVPVRLGLQRA
00464421   1/1  lddtelllfalqllfatPladraehleelikpalaagklgaldlivilDRyidsdllafaaqgygrglls
00487061   1/1  pdafdn.ellgellealleggkivlsarraqlleirlirpllaegkvvilDrepdsadlafagagyllgg
00469161   1/1  aanragl.relikellaagkgvildrfplsrlayqlsggerqrlaidlegalllerllldepfpdlvifl
00464411   1/1  gll.glikealaegvivildrvglsdlaypgflsggeqqrvaiarall...pkpdlvllldepteeldeR
00533501   1/1  lllvfadrygvlrglikpalaegvsvildrvglsdlaydgfprllsgggrqrvalaralvvkpdlvilld
00420081   1/1  slddaallllslqllfaapylslnevidaarvlladefikplpagykvviiDRhplsallvFplarylgg
00532471   1/1  lpllevlellaarleellerippalsggqgqrvildrslysrpavlllllyvdeplsgldvelreelrdl
00496571   1/1  lhl.glilaalaagvgvvldrvglsdlay.gfprtlsglgqrqrvalarallkpdlvifldeppteelde
00487021   1/1  rgllk.......aerlervevllervgllldrippalsgGqgqrvildrallselayqpdvllldeplsg
00486921   1/1  .....dlllevieellaag.gvildgfplslegaqalra...........llrelgldpdlvifldappe
00493061   1/1  laevrelllevleealaag.gvildgfprtiesaealrallle..............lglppdlviflda
00478131   1/1  alleealealkagdvvildgfgrslaarq.........lllellrelgrvvkpdlvifldappevlleRl
00515801   1/1  .....dlllevirellaag.gvild............gfpldleqaealrallkelglrpdlvifldasp
00478081   1/1  defrelleealalladgdvvilDgfgrlldarq.........lleelllllleepppdlvifldadpevl
00515351   1/1  ..........rglllealeellaagkvvildglsggllqrvallral...............lrpdlvif
00533151   1/1  ........llfddefrglllerleellargpvvildgf........pggllqrealrrll.......lrp
00464591   1/1  dalvrdlllevikellaaggvvldgfpldleqaellrel................gprpdlviyldasle
00496061   1/1  gll......rerldelielllagg.vvildgf............pldlegalllrealarallpdlvifl
00486891   1/1  llfraevrdllyelllealeaggvvl.dgf............pldleqaellrellkelglppdlvifld
00518511   1/1  dlgflileifealieggflledrvvlsllayqgvildggglvledrdalrkllpkpdlviyldaspeell
00457851   1/1  .....llffdeldellkerieellaag.gvild............gfpldlegaealreallragplpdl
00475381   1/1  alfprltvlenvllgllllgglvvildggvrqrlalarallldpdvllldeplllldaalrdlpdlvifl
00457881   1/1  vrdlllelleelladgkgvildgfprdleqaeal...........rallaelglppdlvifldaplevll
00498811   1/1  ielllenlalglalegvildalrrrllelldll.........gldvvilegplllsgglrq..rpdlvif
00478391   1/1  llideidlllakgkvvildgtnlsealdealrrllr................pdlvifldapleelleRl
00489391   1/1  aelllealae............aegkvvild..........gtg..ldieqrealrelllelprpdlvif
00499331   1/1  lvddev......rrlllealdelllaggkvvildgf........pggllqrealrrll.......prpdl
00434401   1/1  .......lreglgidfqlpdaldrellreevlellglgevvivdvydlsggerqr.aralasgpdvlilD
00512061   1/1  lgelvfralelgllldeiekllakgkvvildgtllgteqreal......................dlvif
00482721   1/1  laellfgdll.alalldgvvydrlrdellaelsgg....qgdvliiegalllepgllplpdlvifldapp
00499191   1/1  aldrelllelll.alveglvvlldryprllsggqrqrvaiadpdvlild.gptllldpelrpladlvifl
00493171   1/1  ..dagelledaivigllyergtlldavegalldgfpvlldgalqlllllrel..................
00489631   1/1  atvlenlalllldeidkaledggvvlldgfdrsqlqrlailrallddp.............pdlvvflda
00501941   1/1  llldeidellekggivildgfllt.....................lrellpepdlvvfldaslevlleRl
00462761   1/1  fqdpdllpfl.............tvlenvllpllaaglivivdgt.lllvglrealrkll.....gllsg
00472911   1/1  fedaleagfrqrladlirallakgkvvildgtglsreare............ellellkelg.pvlvifl
00479331   1/1  .prillldeilellekggivldd..................ggrnllrallrellspdlvifldappevl
00477721   1/1  arfrkllielldellaaggvvldlgrtlllrralrellreldl..................vvfldaple
00493981   1/1  laeraeflillideidklleegkvvildgtplllealrellreld..................lvvflda
00516041   1/1  fdearelvpelallfideidellakgkvvild..........gtgrlleldealellg.......pdlvi
00476071   1/1  allfglelegalldglvygvlqdrllerllaagpdvlildgpllldvell....plpdlvifldappevl
00480441   1/1  daivhgllygtskerieealdaglgvlldgfprglsqaqal..................rlaldlvllld
00493431   1/1  llegaevhgllygtskerveealekgllvlldr..................dlsggqqlrvalaralvvf
00491901   1/1  ......prellidlikellkag.vvildgtnlgleqlral......................dlviflda
00508671   1/1  sded............raalrrrlgevfqelllagrlvvld............gtalglelrdelrellk
00451571   1/1  lvpdeiviellrealeelda..dgvildgfp................rllgqaelllsggkadlviflda
00459701   1/1  llldallkalkagggdvvilDgtaltleqrea............llellkelglpdlvvfldtpleelle
00480501   1/1  aalselvlevllealegggnpdvvildgt..............nlleedrellrellkrlgrpdlvifld
00461621   1/1  lerllfldegggflldgfp.rtleqaealskpavlsggrkqrlalaralavdpe.lildgrllgrrllpl
00477561   1/1  eelvrellkellarllaeggdvvilDgtnltleqrealrrllkel............grpdlviyldapd
00381441   1/1  ltvlenlylglllalllaleegkivildgd......................reraeellellgldadlv


                         +         -         -         -         -         *         -:210
query           TTRCQQLDRFEQEKIDFFDRARTIYLSLAKKYPDQYRLIDSSLPLTRVQEAIQKVIMAFLEENRDA----
00464421   1/1  lellrelfslllglpkpdlviyldvdpeealeRikkRg...rrfEsidleylekvreaYlel--------
00487061   1/1  ldleevkaleelllvlpkpdlviyldadpeelleRlkkRg...rdiEeieleylervrelye--------
00469161   1/1  daspeelleRllkRgreergrdldtee.vieerlervrdeylplaelykaadvlvid-------------
00464411   1/1  llkRg...rllek..leyikkrlehylelaepykddvvvidangsieevveeilk---------------
00533501   1/1  eplevldeRlrkrg.rlelreldseevlekrlehylellekad.rvvvidaggsleevveeile------
00420081   1/1  dlslealnallktleelpppdlivlldaspeellkRirkRg...rpgev---------------------
00532471   1/1  leslllvlplpdlviyldadpeelleRllkRgr..dpeeqerlddleevlekylel--------------
00496571   1/1  Rlrkrl.rlgdteevlehrleraeeladrlialyegavvvidasglsleevveeileileel--------
00487021   1/1  ldaklreelrdllrellpegilpdlvifldadpeelleRllkRgreserg..epldlleevle-------
00486921   1/1  vlleRllkr.grpddseeeilerlerlreeyeplleeyddavvvidadgsieevve--------------
00493061   1/1  ppevlleRllkRg.dseevieerlerllrllerllelykeadd.lividaslsiee--------------
00478131   1/1  lkRgrgseddieeelleallrilepylrllaelperadlviinadlsleevveeile-------------
00515801   1/1  eelleRllkrg.dseevieerlerllrllerllelyeeadd.vividasgsieevveeileile------
00478081   1/1  leRllkRgrrerkddseevlellekrleryepllel.yeeadalviinaglsleevv-------------
00515351   1/1  ldapleelleRllkR....ddseeeilerleryreeleplleeyddalvvidadgsleev----------
00533151   1/1  dlvifldapleelleRllkrgrlirled.dseevlekrlerylklyerliepyeeaddvi----------
00464591   1/1  elleRllkrgdseeriekrleelkellerlrelyrelalllpadlvvidaslsieev-------------
00496061   1/1  dapleelleRllkr.grllereddseevlekrlerylelyerliepykkadyvivid-------------
00486891   1/1  appeelleRllkRg.dseevieerlerllrllerllelykeadd.vividaslsie--------------
00518511   1/1  eRllkR...grplese..ellekrleayeelaplyelddlvidtsglsleevveeil-------------
00457851   1/1  vifldapleelleRllkrgreplddteevilkrlerlrelyerliepyeeaddvivi-------------
00475381   1/1  dadpeelleRllkRg..rergeaidleylervreryeelarelael------------------------
00457881   1/1  eRllkrg...ddpe.ealekrlklyepllelyeeady.lividaslsieevveeileil-----------
00498811   1/1  ldappevlleRllkR.......ggldeetiekrlelylelaplygaadividndlsle------------
00478391   1/1  lkr.....grhpeseevleerleryepllepea.adlvidtslsleevveqilellee------------
00489391   1/1  ldadpeelleRllkrglrp.eregdseevlekrlerylellerliepyeeaddvivida-----------
00499331   1/1  villdappeelleRllkr.grldgreddslellekrleryeeltrdlielyeeadrv-------------
00434401   1/1  gptlgldvlldl.........pdlvifvdhdlevalerrl------------------------------
00512061   1/1  ldapleelleRllkrg..rdpleaielrylerlarayeeleplydadlvidnddlsleevv---------
00482721   1/1  evlleRllkRg...gdseeeiekrleryre..iaplleaad..lvidndgsleevveqile---------
00499191   1/1  daspeelleRllkRgrlergddleevlerilervrpdylrlieplkeradlvidnsldleev--------
00493171   1/1  llkpdlvilldvslevlleRllkRg.......rdseevikkrleryleet.plidyyd------------
00489631   1/1  pleellerllkR...dgrteeeilerlarleery.......radlvivtddl......evveki------
00501941   1/1  lkRggrfderie.pledleerleilealykeead.lvidtsglsleevveeilelle-------------
00462761   1/1  GqkqrvadlvvlldadpevllaReptr..gldpe...teeeleellerleereplygadivi--------
00472911   1/1  dadpevlleRllkr..grallreevldrllevrepy....elleeadlvidtsglsleevve--------
00479331   1/1  lerllrrgrldllvdeerleellkllekllplykeead.lvidtsglsleevveli--------------
00477721   1/1  elleRllkRggrfdllielplleelkeilrellplykelad.lvidtsglsleelve-------------
00493981   1/1  ppeellerllkRpgrfdrrilipeeilerlleilerllaplleaadlvidtsgsleevveeile------
00516041   1/1  fldappeelleRllkr....gldeeaieerlerlreilepleea..ddlvidtanldleevveeilel--
00476071   1/1  leRllkRg.......gdsleeiekrlerylelaplyeeadlvidndglnllsieevveqilelleel---
00480441   1/1  pslevlleRllgr....gddteevirkrlerlapeleyyee.lgladvvivnddleealelll-------
00493431   1/1  ildpslelldeRlsgrda..........dtreeirkrlkrlleelgplieydyvivnddlee--------
00491901   1/1  plevlleRllkrg..rdlpelirlrdlerlarlleeledlyeedlvidtdglsleevver----------
00508671   1/1  eaglpllvvfldaplevlleR.....drrglypeelsgglkqrvaiarplelaaepd.------------
00451571   1/1  plevlleRllkr...ddekilkrleeqkqrvaiarallkkpa.ilildept.slde--------------
00459701   1/1  Rllkrlkrplpgrldrrieeiledlkgrleiyekptepll------------------------------
00480501   1/1  aple------------------------------------------------------------------
00461621   1/1  pdlvifldaspeelleRllkrgrergllvrlddleerilkrdlrdylreieplkdyadv-----------
00477561   1/1  eelleRllkrrkedrp.dlldkdleelleefegrddeyeppyepaddiieidlsrleiyevitki-----
00381441   1/1  iilpasleellerld-------------------------------------------------------