[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58185.1


[Show Plain Result]

## Summary of Sequence Search
   1::212
   1::208  1.4e-58 45.7% 0042783 00427831 1/1   lo-hydrolase/oxidoreductase             
   1::207  1.4e-56 40.9% 0039825 00398251 1/1   lo-hydrolase/oxidoreductase             
   1::208  1.6e-54 38.0% 0043666 00436661 1/1   lo-hydrolase/oxidoreductase             
   1::200  1.6e-51 39.7% 0051638 00516381 1/1   lo-hydrolase/oxidoreductase             
   1::208  8.8e-50 37.0% 0045185 00451851 1/1   lo-hydrolase/oxidoreductase             
   1::200  2.4e-48 38.4% 0051022 00510221 1/1   lo-hydrolase/oxidoreductase             
   6::211  2.4e-45 35.6% 0048073 00480731 1/1   lo-hydrolase/oxidoreductase             
   3::214  4.8e-45 29.4% 0051275 00512751 1/1   lo-hydrolase/oxidoreductase             
   1::208  1.2e-44 32.7% 0051980 00519801 1/1   lo-hydrolase/oxidoreductase             
   5::213  1.5e-44 36.5% 0036363 00363631 1/1   lo-hydrolase/oxidoreductase             
   6::210  1.7e-42 38.7% 0047843 00478431 1/1   lo-hydrolase/oxidoreductase             
  13::212  7.4e-42 35.0% 0045733 00457331 1/1   lo-hydrolase/oxidoreductase             
   7::208    2e-41 33.2% 0048716 00487161 1/1   lo-hydrolase/oxidoreductase             
   1::197    9e-41 35.0% 0046465 00464651 1/1   lo-hydrolase/oxidoreductase             
   3::210  2.6e-40 32.3% 0050726 00507261 1/1   lo-hydrolase/oxidoreductase             
   4::197  5.4e-40 35.6% 0050252 00502521 1/1   lo-hydrolase/oxidoreductase             
  23::207  3.6e-37 31.6% 0051863 00518631 1/1   lo-hydrolase/oxidoreductase             
   1::201  8.5e-33 28.3% 0051194 00511941 1/1   lo-hydrolase/oxidoreductase             
   1::195  4.5e-31 26.3% 0051591 00515911 1/1   lo-hydrolase/oxidoreductase             
   1::196  2.8e-30 39.7% 0050210 00502101 1/1   lo-hydrolase/oxidoreductase             
   3::196  2.8e-30 29.6% 0050873 00508731 1/1   lo-hydrolase/oxidoreductase             
   1::173  4.8e-28 28.0% 0052141 00521411 1/1   lo-hydrolase/oxidoreductase             
  14::197    4e-21 27.7% 0051102 00511021 1/1   lo-hydrolase/oxidoreductase             
   1::212


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MKFEILPVTRFMQNCTLLGCEESGKAAVVDPGGDVEQILARAEAGCLKIEKILLTHGHIDHAGGAGELAR
00427831   1/1  mkitvlgvgs.gtnsylvetgdggeailiDpg.dadallaalkalglkidaillTHgHaDHigglpelak
00398251   1/1  Mkitvlgagsevadnvypltvlggnsylietg..ggaiLiDpglggsadallaalkalgldpedidaill
00436661   1/1  Mkitflgagsalpvplllpgallevadgvyvldgvggnsylietg..ggaiLiDtglgpdadallaalka
00516381   1/1  Mkltflgsgsavpdpgplgelggnsylietg..gkaiLiDtGlgldadallealkelgldpedidavllT
00451851   1/1  mkitflgsgsglpevadgvyvvrgldlgglgevggnsylietg..ggaiLiDtglslgdaeallealkel
00510221   1/1  mkitflgvgg.gtnsylivdetgggailiDpg.gadallealkalglkidaillTHaHaDHigglpalle
00480731   1/1  -----slglfevapgvlvlrfldlggltelggnsylietg..ggaiLiDpglgpgfaeallaalkallg.
00512751   1/1  --sklvevadgvylvrgpdpkitplgglgefldvglgtnsylie.g..ggaiLiDpglsgdaegllealk
00519801   1/1  ppsgemkitflgvgggqgnsylietg..gkaiLiDtGlgfplssgrlsrllllrlplvdlfllgadeilp
00363631   1/1  ----pkllelteladgvyvitlilplgglgesggnsylietg..ggailiDtgltfpdaepllaalkelg
00478431   1/1  -----dlplllallllglglfevapgvyllrvldlggltglggnsylietg..ggaiLiDpGlgpglaea
00457331   1/1  ------------gleildglalvevapgvylvlgflplggltvlggnsylietg..ggaiLiDpGlgpgf
00487161   1/1  ------aapllgllvpglyrlklgdmkvtvldvgtllldlgalfgvvplelapglliiplpglgglggns
00464651   1/1  mllevapgvyllrlldlellvlglggvlevgqgnnsyli.tg..gkaiLiDpglsagadallaalkal.i
00507261   1/1  --itflGtgg.ggpsylletg..geriLiDaGegtlrallr...kllkidaiflTHgHaDHigGlpglll
00502521   1/1  ---ladllllllliadgvlllrelapgvyvldlgglgetglggnsylietg..ggaiLiDpglgegadrl
00518631   1/1  ----------------------nllltggkaiLiDpglglralllllallgl..davllTHaHaDHiggl
00511941   1/1  MkltflGtggsvpvpgrngnsylietlddgggriLiDcGegllrqllalgldpkkidaiflTHlHaDHig
00515911   1/1  Mkltflgtgsslpvperggnsylietg..gkriLiDcGlglleqllr.gidpkdidavllTHlHaDHigg
00502101   1/1  kmkitflg.....gnsylietg..gkailiDpg....pllaalgidplkidavllTHaHaDHi.glpall
00508731   1/1  --rdlspteladgvyalggngelggnsylivtd..ggavLidagpspalaeallaalkklglkpvdavll
00521411   1/1  MkltflGtggsvptpgrngssylletpldgggkriLiDcGegllrqllalgidpskidaiflTHlHaDHi
00511021   1/1  -------------mkvtvlGsgdggglPqwnclcklcrlvrgidlgllggtgnsylietdggr.liLfDt


                         -         -         *         -         -         -         -:140
query           RLEVPIEGPQIEDEFWIDSLPAQSEMFGFPPVRAFVPDRWLEQGDRVSFGKVVLNVYHCPGHTPGHVIFF
00427831   1/1  atgapvyapeetaell....................pdrtledgdtltlggltvevlhtpgHtpghvsyl
00398251   1/1  THlHaDHigglpellefpgapvyaheaeaellrdplkllralylfglllplialpdrlledgdtlelggl
00436661   1/1  lgldpedidavllTHaHaDHigglpellkrpgapvyaseataellralladagalygerlllpalpdrtl
00516381   1/1  HlHlDHigglpll...pnapvyaheataelledlllllalllglllvlallpdilledgdtlelgg..le
00451851   1/1  gpkdidavllTHgHaDHigglpaller.gapiyaseltaellkal.............glvlpditledg
00510221   1/1  afgapvyapegtaellral..................drpledgdtlelggltvevlptpgHtpgslgll
00480731   1/1  kdidavllTHaHaDHigglpallea.gapiyapegtael.............llllglplpvreledgdt
00512751   1/1  al.lglkdidavllTHaHaDHigglpalleafpgapvyapegtaellra...........lllllllpvr
00519801   1/1  alkelgidkidaillTHaHaDHigglpellkrfpnapvyapkataellkdklkllfategfspllpalla
00363631   1/1  kkidaillTHgHaDHigglpylle.pgapiyaseltaellkaklpe..............plvtlkdgdt
00478431   1/1  llaalkellg.lkidavllTHaHaDHigglpallea.gapiyapegtaellrallkl..........lpp
00457331   1/1  aeallealkalglkdidavllTHaHaDHigglpallea.gapvyapegtaellrall.............
00487161   1/1  ylietg..ggaiLiDpGlgldaarllgallealkalgldpedidavllTHaHaDHigglpalleatfpga
00464651   1/1  glkdidavllTHaHaDHigglpallerfpgapiyapegtaellka.......llglpflp....vreled
00507261   1/1  tlllllgarkpglpiygppgtlelleallklsglllgfplilellplelieledgetlelggltvtvipt
00502521   1/1  lealkal.iglkdidavllTHaHaDHigglpalleafnpgapiyapegtaellkallk............
00518631   1/1  palle..gapvyappgtaellrslladaglllylllgvlplllpvieledgdtlelggltvtvlptpgHt
00511941   1/1  Glpgllltllllgrfpplpiygppgtaelleallkdsglllgfp.....lrfheledgetlelggltvta
00515911   1/1  lplllrallllgllllrfpnapvyappgtaelleallkl...........pllrvielddgetlelgglt
00502101   1/1  ealpa....................................lkdgdtlelggltvtvlpaghtpghgdlt
00508731   1/1  THgHaDhvgglpyllea.gapiyaseataellkellkvllaslgpllgeiapltlvlplvvledgetlel
00521411   1/1  gGlpgllktllllgrgpplpiygppgtaelleallkdsglllefp.....levheledgevlelggltvt
00511021   1/1  gpdirafadallenlkalgidlsdidavvlsHahpDHigglpallelfpapvyaspgtaellkallpll.


                         +         -         -         -         -         *         -:210
query           HPESHLALVGDVLFKGSIGRTDFPRGDYDALIHSIRKRLFPLGDEVRFIPGHGPMSTFGEERQSNPFVGE
00427831   1/1  ledeggsdplvlftGDtlfvggigrtdl..gdaeqllasllekllalpddtlvypgHgptlsnlkfla--
00398251   1/1  tlevlhtpGHtpgsvsllleeggvlftGDtlfsggigrpdlllleigglpdgdheallesl.eklla---
00436661   1/1  edgdtltlggltlevlhtpgHtpgslgllledgkvlftGDtlfvgglgridlllpeaglpdgdpeall--
00516381   1/1  vlhtpgHtpghlgflleeggggkvlftGDtlf.ggigrldlpfgadllllesslekllel----------
00451851   1/1  dtltlggltvevlhtgpghtpgslvlllpdgkvlftGDllfsgglgrldlpfggdlaellesleklla--
00510221   1/1  ipggkvlftGDtlfipgigr..lpggdlaallesl.ekllalpddtlvlpgHgptlsnle----------
00480731   1/1  lelggltvevlptppgHtpgslgllipggkvlftGDtlfsgglgridllpggdlaallesl.ekllallp
00512751   1/1  eledgdtlelggltvevlptpglHtpgslglliedggvlftGDtlfsgglgridlglggddllileatyg
00519801   1/1  kgiplrvievkdgdtlelggltievlptpgHtpgsvgyyieedlngdslvllielgggkvlftGDtlf--
00363631   1/1  ltlggltvevlhtgpghtpgsvvlylpegkvlftGDllfsggtgrldl..gdleqllesl.ekllellld
00478431   1/1  lpvreledlgdtlelggltv.vlptpgHtpgslgllipggkvlftGDtlfdgglgridllpggdlaalle
00457331   1/1  pplpvreledgdtlelggltvevlptppgHtpgslgllipggkvlftGDtlfigglgridllpggdlaal
00487161   1/1  pvyapegtaellrdllldllalqelvgellglleelllpllpalpvreledgdtlelG...levlatp--
00464651   1/1  gdtlelggltvtvlptpglHtpgslglliedggvlftGDtlfspdpglldllgdadv-------------
00507261   1/1  p.HteapgsvgyrieekdrlgkfealglppgpllgklklgddvvllietpggkvlftGDtlfgp....ld
00502521   1/1  .plpvielddgdtlelggltitvlptpglHtpgslglli.g.kvlftGDtlfsgglg-------------
00518631   1/1  pgslgllietpggrvlftGDtlfs.....gdlpdgdllallesldadllllestylvvpghgp..nl---
00511941   1/1  ipvp.Htpgslgyrietktgdgkfdveklkelglplgpllgllkegvlvlledgtvilpsd---------
00515911   1/1  vtalpa.gHtpgslgyrietgggkvlfsGDtgfspellelakgadllileatygd---------------
00502101   1/1  pgslgflietpggkilftGDtlfspdlgrldelggadvlileatggdhstleeal.--------------
00508731   1/1  gg..levtatppgHtpgslvvllegggvlftGdllfs...glpnlldadlaawles--------------
00521411   1/1  alpvp.Htpgslgyrieekalpgkldveklkal-------------------------------------
00511021   1/1  ..flldllglplpvivlkdgetlelgllggltvtalhtpghtpghlpedkilfsgds-------------


                         -         -         -         +         -         -         -:280
query           KI--------------------------------------------------------------------
00427831   1/1  ----------------------------------------------------------------------
00398251   1/1  ----------------------------------------------------------------------
00436661   1/1  ----------------------------------------------------------------------
00516381   1/1  ----------------------------------------------------------------------
00451851   1/1  ----------------------------------------------------------------------
00510221   1/1  ----------------------------------------------------------------------
00480731   1/1  d---------------------------------------------------------------------
00512751   1/1  lvdv------------------------------------------------------------------
00519801   1/1  ----------------------------------------------------------------------
00363631   1/1  atl-------------------------------------------------------------------
00478431   1/1  ----------------------------------------------------------------------
00457331   1/1  le--------------------------------------------------------------------
00487161   1/1  ----------------------------------------------------------------------
00464651   1/1  ----------------------------------------------------------------------
00507261   1/1  ----------------------------------------------------------------------
00502521   1/1  ----------------------------------------------------------------------
00518631   1/1  ----------------------------------------------------------------------
00511941   1/1  ----------------------------------------------------------------------
00515911   1/1  ----------------------------------------------------------------------
00502101   1/1  ----------------------------------------------------------------------
00508731   1/1  ----------------------------------------------------------------------
00521411   1/1  ----------------------------------------------------------------------
00511021   1/1  ----------------------------------------------------------------------