[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Result of HMM:SCP for noce0:ABA58187.1


[Show Plain Result]

## Summary of Sequence Search
   1::377
 177::356  1.8e-35 32.4% 0048023 00480231 1/1   CoA N-acyltransferases (Nat)            
 186::357  5.7e-34 37.4% 0048344 00483441 1/1   CoA N-acyltransferases (Nat)            
   1::377


## Multiple Alignment
                         -         -         -         -         +         -         -:70
query           MEFKVTESIETVASGQWNALEGTDNPFLRYEFLSALERYGCVGAHVGWLPRYLLAEDRPGSLIGAVPLYL
00480231   1/1  ----------------------------------------------------------------------
00483441   1/1  ----------------------------------------------------------------------


                         -         -         *         -         -         -         -:140
query           KYNSFGEFVFDWSWADAWEQAGQHYYPKLVVAVPFSPVTGPRLLLKPGADEAMVDELIQMTIRLAKKGGI
00480231   1/1  ----------------------------------------------------------------------
00483441   1/1  ----------------------------------------------------------------------


                         +         -         -         -         -         *         -:210
query           SSLHWLFPHQKDRKRLANCGFLLRQGYQFHWHNRGYRDFNDFLETLTSKRRKEVRRERRQAQTRGTEIKV
00480231   1/1  ------------------------------------rdfddllaslskklRrnirkarkl....gltire
00483441   1/1  ---------------------------------------------lskklRrnirkarka....gltvrv


                         -         -         -         +         -         -         -:280
query           IHGSEVTDLEWRAMYRFYQATFHAKGNYPALTLPFFKSLGRTMGQAVVLALAVRTGIPIAGALYLRSRDT
00480231   1/1  at.....eedldlfyelyaatla.rkglpylsleffeallealpdnarlfvaeldgelPvAaalvlvdgd
00483441   1/1  lt....tpedldafyrlyaatlrrkg.fpvlsleffeallealpeglallfvaeldgepvAaalllvhgd


                         -         *         -         -         -         -         +:350
query           LYGRYWGDSEYLAGMHFELCYYRGIEYCIEHHLQYFEPGAQGEHKINRGFLPVLTWSAHWLGDSGFYSAI
00480231   1/1  tlyylysgsdpeyrklspgelllyeaiewaierGlkrfdllGasplgspdyllrGlykfKrgfgpelvpl
00483441   1/1  tlyylyggspeyrklgpgelllyeaiewaierGlkrfdlaGasgehkgdglyrfKrgFtgaeivplhglf


                         -         -         -         -         *         -         -:420
query           ADFLAQESRMVRSAIMELEAGGPYKRP-------------------------------------------
00480231   1/1  ygtwll----------------------------------------------------------------
00483441   1/1  dlplnpl---------------------------------------------------------------